![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328787699 XP_392321.3 PREDICTED: protein croquemort |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 6.7* | 25.5 | 67.8 | 0.09882006 | 0.3761062 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 67.3 | 32.7 | 2.058104 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 83.2 | 16.8 | 4.952381 | ||
| Thoracic muscle | |||||
| Fat body | 2.3* | 2.7* | 94.9 | 0.024236038 | 0.028451001 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 3.5 | 42.9 | 53.6 | 0.065298505 | 0.80037314 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.6 | 23.7 | 53.2 | 0.61278194 | 0.44548872 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIYKKLAIISLIGSVLTIIGLITGILWSTIYSSIIHTQLSLTPTSTSYKLWEVTPIPMY LKLYMFNLTNYEDFISINGSKPNFVEMGPYVFREVDYKVEQKWHENDTITYQRKRVWYFE KSLSVGSLQDNVTNINPITASVAYALRYQKPFIRDLVDRIMKAIDQKLIITKTVNELLFE GYDDPMLKIARKMNFTKIPFSKFAWFYGRNGSATYDGTFNMLTGKSNLLNVGIVKEWNFN TRVNYYPGECGIVKGTNGDLWPPLPDNKTISFFVPDICTSMSVTYDNTTIHEGLRGARYI SDDTIFDDGTKVSSRKCYCVGECIPSGALNISLCKWGAPAFISLPHFYLADRSYRENIKG MEPNKEKHELSISIEPKTGVPLNVNAALQLNLLIQNDAHMSMFKNIKKTFVPMLWFTQEA YLTANYARIIKFIIILESLGSITCYGIACIGILFISIGIFLYIRHNFRGEENQVLLSKRF INNDDITSING |
|
| |