| Protein: 48128110 XP_393294.1 PREDICTED: proteasome subunit alpha type-2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.4 | 24.7 | 34.9 | 1.1575931 | 0.7077364 |
| Scape | 34.4 | 31.4 | 34.1 | 1.0087976 | 0.92082113 |
| Brain | 62.8 | 37.2 | 1.6881721 | ||
| Crop | 30.7 | 34 | 35.3 | 0.8696884 | 0.9631728 |
| Eye | 64.5 | 35.5 | 1.8169014 | ||
| Intestine | 24.5 | 41.8 | 33.7 | 0.727003 | 1.2403561 |
| Leg, front | 32.8 | 34.4 | 32.8 | 1 | 1.0487804 |
| Leg, middle | 51.9* | 24.9 | 23.3 | 2.2274678 | 1.0686696 |
| Leg, rear | 62.6 | 37.4 | 1.6737968 | ||
| Mandibular gland | 16 | 84 | 0.1904762 | ||
| Rectum | |||||
| Salivary gland, cerebral | 25.3 | 36.4 | 38.3 | 0.66057444 | 0.95039165 |
| Salivary gland, thoracic | 39.2 | 23.2 | 37.7 | 1.0397878 | 0.61538464 |
| Sternite | 28.8 | 37.3 | 33.9 | 0.8495575 | 1.100295 |
| Tergite | 21.5 | 54.7 | 23.8 | 0.9033613 | 2.2983193 |
| Ventriculus | 34 | 27.8 | 38.3 | 0.88772845 | 0.72584856 |
| Thoracic muscle | |||||
| Fat body | 22.5 | 38.7 | 38.8 | 0.5798969 | 0.9974227 |
| Malpighian tubules | 28.3 | 32.3 | 39.4 | 0.7182741 | 0.819797 |
| Nerve chord | 22.9 | 32.2 | 44.8 | 0.51116073 | 0.71875 |
| Poison sac | |||||
| Sting | 67.1 | 32.9 | 2.0395136 | ||
| Heart | 24.9 | 41.4 | 33.8 | 0.7366864 | 1.2248521 |
| Hypopharyngeal gland | 57.9 | 42.1 | 1.375297 | ||
| Galea | 22.4 | 28.2 | 49.4 | 0.4534413 | 0.5708502 |
| Glossa | 68.1 | 31.9 | 2.1347961 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.3 | 41.1 | 38 | 0.8236842 | 1.081579 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASERYSFSLTTFSPSGKLVQIEYALAAVAAGAASVGIKASNGVVLSTENKHKSILYDEH SVKKVEIITKHIGMVYSGMGPDYRLLVKQARKIAQQYQLIYQEPIPTAQLVQRVAMLMQE YTQSGGVRPFGVSLLICGWDNGKPCLYQCDPSGAYFAWKATAMGKNFVNGKVFLEKRYSE DLELDDAVHTAILTLKEGFEGQMTADNIEIGICDANGFRRLEPSNVKDYLANIP |
 Top
| |