| Protein: 328787985 XP_393284.3 PREDICTED: multiple coagulation factor deficiency protein 2 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.5 | 62.5 | 0.6 | ||
| Scape | 50.1 | 28 | 21.9 | 2.2876713 | 1.2785388 |
| Brain | |||||
| Crop | 38.8 | 61.2 | 0.63398695 | ||
| Eye | |||||
| Intestine | 55 | 45 | 1.2222222 | ||
| Leg, front | |||||
| Leg, middle | 70.3* | 29.7 | 2.3670034 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 81.3 | 18.7 | 4.347594 | ||
| Salivary gland, thoracic | 36.7 | 21.1 | 42.2 | 0.86966825 | 0.5 |
| Sternite | 13.1 | 47.8 | 39 | 0.33589745 | 1.225641 |
| Tergite | 68.9 | 31.1 | 2.215434 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 23 | 47.3 | 29.7 | 0.7744108 | 1.5925926 |
| Malpighian tubules | 54 | 46 | 1.173913 | ||
| Nerve chord | 39.8 | 27.8 | 32.4 | 1.2283951 | 0.8580247 |
| Poison sac | 24.2 | 75.8 | 0.31926122 | ||
| Sting | 39.8 | 60.2 | 0.6611296 | ||
| Heart | 17.8 | 42.6 | 39.6 | 0.44949496 | 1.0757576 |
| Hypopharyngeal gland | 14.5 | 85.5 | 0.16959064 | ||
| Galea | 36.4 | 63.6 | 0.572327 | ||
| Glossa | 46.2 | 13.4 | 40.4 | 1.1435643 | 0.33168316 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.6 | 36.2 | 45.8 | 0.930131 | 0.790393 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNWTLCLFIIGCFCCKYLYAQQQRIPPGVSPQHYQQPQFQQVHQVPQQIPQQQQMPGQVP MQQVPVQQVPVQQQHIPTHQVPIQEHGQAILNAANIVHEKAHIAEHMEVPIDTSKMTEQE LQFHYFKMHDADNNNKLDGCELIKSLIHWHEQEKKEIGGVNTGPKLFKDEELVTLIDPIL SLDDTNNDGYIDYPEFIQAQKNAGATGRQ |
 Top
| |