| Protein: 328786878 XP_391860.4 PREDICTED: serine/arginine-rich splicing factor 4 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 63.8 | 36.2 | 1.7624309 | ||
| Brain | |||||
| Crop | 39.5 | 28.7 | 31.8 | 1.2421384 | 0.9025157 |
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 82.8 | 17.2 | 4.8139534 | ||
| Salivary gland, thoracic | 63.1 | 36.9 | 1.7100271 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.4 | 49.3 | 15.3 | 2.3137255 | 3.2222223 |
| Malpighian tubules | 24 | 30.3 | 45.7 | 0.5251641 | 0.6630197 |
| Nerve chord | 38.4 | 38.1 | 23.5 | 1.6340425 | 1.6212766 |
| Poison sac | |||||
| Sting | |||||
| Heart | 37.3 | 33.1 | 29.6 | 1.2601352 | 1.1182432 |
| Hypopharyngeal gland | 47.3 | 52.7 | 0.8975332 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.9 | 44.2 | 32.1 | 1.3364486 | 1.376947 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTRVFVGGLTYRVRERDLEKFFRKYGRIKEVAMKNGFAFVVSLMWFNCFFYSMVGTRVY VGGLPYGTRERDLERFFRGYGRFRDVLIKNGYGFVEFDDYRDADDAVYELNGKELLGERI TVERARGTPRGSDQWRYGDSRGGYGDSRRSARDDMRHDRDSVNRNTRTASSYKQSLPRYG PPTRTEYRLTVENLSSRVSWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFATYSDLKNAI DKLDDTELNGRRIRLIEDKRRGRRSRSSSSRSRSRSRSRSRRRSRSRSRSRRSSRSRSRR SSRSKSRAHTKSKSKSKSKSPERSRTRSKSKSRDRSKSKSKSKSKSRSRSRSKAERSKSR SQSKSKAKSPSKDRSSRERSRGDISRSRSGSKHSKSRSRSRSPMNGDKSPESNKQKVVD |
 Top
| |