| Protein: 66530373 XP_623497.1 PREDICTED: trans-12-dihydrobenzene-12-diol dehydrogenase-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.4 | 47.1 | 22.5 | 1.351111 | 2.0933332 |
| Scape | 17.3 | 51.6 | 31.1 | 0.5562701 | 1.659164 |
| Brain | 69.4 | 30.6 | 2.267974 | ||
| Crop | 17.3 | 42.2 | 40.5 | 0.4271605 | 1.0419753 |
| Eye | |||||
| Intestine | 31.6 | 37.1 | 31.3 | 1.0095847 | 1.1853036 |
| Leg, front | 35.9 | 42.2 | 21.9 | 1.6392694 | 1.9269407 |
| Leg, middle | 31.8 | 44.5 | 23.7 | 1.3417722 | 1.8776371 |
| Leg, rear | 61 | 25.3 | 13.7 | 4.4525547 | 1.8467153 |
| Mandibular gland | 69.5 | 30.5 | 2.2786884 | ||
| Rectum | 22.6 | 20.2 | 57.2 | 0.3951049 | 0.35314685 |
| Salivary gland, cerebral | 62.4 | 37.6 | 1.6595745 | ||
| Salivary gland, thoracic | 27.9 | 37.7 | 34.4 | 0.81104654 | 1.0959302 |
| Sternite | 52.7 | 35.7 | 11.5 | 4.5826087 | 3.104348 |
| Tergite | 23.9 | 33.1 | 43 | 0.55581397 | 0.76976746 |
| Ventriculus | 35.7 | 24.3 | 40.1 | 0.8902743 | 0.60598505 |
| Thoracic muscle | |||||
| Fat body | 17.8 | 17.5 | 64.7 | 0.2751159 | 0.27047914 |
| Malpighian tubules | 28.4 | 34.4 | 37.2 | 0.76344085 | 0.9247312 |
| Nerve chord | 11.4 | 67 | 21.5 | 0.53023255 | 3.1162791 |
| Poison sac | |||||
| Sting | 47 | 53 | 0.8867925 | ||
| Heart | 9.3 | 39.2 | 51.5 | 0.18058252 | 0.761165 |
| Hypopharyngeal gland | 65.1 | 34.9 | 1.8653295 | ||
| Galea | |||||
| Glossa | 82.4* | 17.6 | 4.681818 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.6 | 43.2 | 34.1 | 0.9560117 | 1.2668622 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAIHWGIAGAGKISHDFVSSLQTLPESEHVVVAVAARELSRAQNFSSLHKIKKAFDSYTK LAEDNDIDAVYIGTLHPQHFEIAKLMLNHGKHVLCEKPLTMNLKQTTELINLAKEKKLFL MEGIWSRCFPIYEIVKKEIESGSIGEIYQVLVTFGFKMPDIERLNIKNLGGGTILDLGVY GIQFACLIFGNEMPHTIQATGCLNEEGVDQSASISFLYKGNHTATILTHSRVDLPNEAYI IGTKGMIKVPKFWCPTTVELPNEIVNVSLPETKSKFNFINSVGLSYEANEVRNCILKGMI ESPKVPHNVSLLIAQLEDEIRKQIGVTYPED |
 Top
| |