| Protein: 48106841 XP_396167.1 PREDICTED: cAMP-dependent protein kinase type I regulatory subunit isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 25.6 | 35.5 | 38.9 | 0.6580977 | 0.9125964 |
| Brain | |||||
| Crop | 33.1 | 66.9 | 0.49476832 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 41.9 | 29.4 | 28.7 | 1.4599303 | 1.0243902 |
| Leg, middle | 43.1 | 20.9 | 36.1 | 1.1939058 | 0.57894737 |
| Leg, rear | |||||
| Mandibular gland | 33.3 | 66.7 | 0.49925038 | ||
| Rectum | |||||
| Salivary gland, cerebral | 17.7 | 82.3 | 0.21506684 | ||
| Salivary gland, thoracic | 39.7 | 30.8 | 29.5 | 1.3457627 | 1.0440677 |
| Sternite | 90.4* | 9.6 | 9.416667 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 71.2 | 28.8 | 2.4722223 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 55.8 | 44.2 | 1.2624434 | ||
| Heart | 53.6 | 18.6 | 27.8 | 1.9280576 | 0.66906476 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.9 | 30.2 | 41.7 | 1.1966426 | 0.72422063 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAANLEEEQSLRECEEYVQRHNIQQVLKDCIVQLCVGRPENPISFLREYFQKLEREQAHD AKQQIATSPEDTEDIPAGQQGPQVPRRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALS KAIAKNVLFAHLDENERSDIFDAMFPVTFLPGEAIIRQGDEGDNFYVIDQGEVEIFVNGE LATTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEF LSRVSILESLDKWERLTVADALEPVAFDDGETIVRQGEPGEDFYIIVEGTAVVLQQRSEG EEPAEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRN ITQYNSFVSLSV |
 Top
| |