| Protein: 299890788 NP_001177743.1 cytochrome b-c1 complex subunit 10 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 67.6* | 18.4 | 14 | 4.8285713 | 1.3142858 |
| Scape | 28.3 | 48.8 | 22.9 | 1.2358079 | 2.1310043 |
| Brain | 24.9* | 75.1 | 0.33155793 | ||
| Crop | |||||
| Eye | 15.6* | 84.4 | 0.18483412 | ||
| Intestine | 19.4* | 80.6 | 0.24069479 | ||
| Leg, front | 30.2 | 16.7* | 53 | 0.56981134 | 0.31509435 |
| Leg, middle | 36 | 22.9 | 41.1 | 0.8759124 | 0.5571776 |
| Leg, rear | 19 | 29.9 | 51.1 | 0.37181997 | 0.5851272 |
| Mandibular gland | 61.1 | 38.9 | 1.5706941 | ||
| Rectum | |||||
| Salivary gland, cerebral | 11.7 | 88.3 | 0.13250282 | ||
| Salivary gland, thoracic | 70.8 | 29.2 | 2.4246576 | ||
| Sternite | 36 | 41.9 | 22.1 | 1.6289593 | 1.8959275 |
| Tergite | 58.4 | 41.6 | 1.4038461 | ||
| Ventriculus | |||||
| Thoracic muscle | 40.5 | 59.5 | 0.6806723 | ||
| Fat body | |||||
| Malpighian tubules | 65.9 | 9.9 | 24.2 | 2.7231405 | 0.4090909 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 54.3 | 45.7 | 1.1881838 | ||
| Hypopharyngeal gland | |||||
| Galea | 48.8 | 51.2 | 0.953125 | ||
| Glossa | 45.8 | 32.7 | 21.5 | 2.1302326 | 1.5209303 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.4 | 27.7 | 46.9 | 0.92537314 | 0.5906183 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: | MKIGKRHFEIATKWIPSLMVYTGAAGLAMVFVTDWKVIAGYIPFYGNKFKD |
 Top
| |