| Protein: 328790061 XP_392304.4 PREDICTED: hypothetical protein LOC408772 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 67.7 | 32.3 | 2.0959752 | ||
| Scape | 69.8* | 13.1 | 17 | 4.105882 | 0.7705882 |
| Brain | 24.2 | 75.8 | 0.31926122 | ||
| Crop | 36 | 37.1 | 26.9 | 1.33829 | 1.3791821 |
| Eye | 67.2 | 32.8 | 2.0487804 | ||
| Intestine | 62.6 | 37.4 | 1.6737968 | ||
| Leg, front | 59.1* | 20.1 | 20.8 | 2.8413463 | 0.96634614 |
| Leg, middle | 24.8 | 33.9 | 41.3 | 0.60048425 | 0.82082325 |
| Leg, rear | 29.1 | 39.5 | 31.4 | 0.9267516 | 1.2579618 |
| Mandibular gland | 16.8 | 83.2 | 0.20192307 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 45.2 | 23.7 | 31.1 | 1.4533762 | 0.7620579 |
| Sternite | 87.9* | 12.1 | 7.264463 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 45.4 | 23 | 31.6 | 1.4367088 | 0.7278481 |
| Poison sac | |||||
| Sting | |||||
| Heart | 36 | 5.9* | 58 | 0.62068963 | 0.10172414 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.8 | 24.5 | 38 | 1.3105264 | 0.6447368 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGARQSRRSVDITTTPKKEGLPADGGVGDAAAPGDGKLERIEETDTKPTTNGIAPHTDVP EDKDKDKDDATEKEKDKEQQEEVKETKQESGGESPAETAEVTTPTEASTPNTATSPDNKE TKKKEKMKKKWSFRSISFSKKDKNKPAREEAPKNGDVTKEEPLAEGGEEQENGSGTAGSP VEEKSAVSSPTTENEEATAAAVAAAAAAAAPAAAATAATTAAATPSSPSSPQPPSSAAET KQQQEESSGAASAAASGASPLEEKTEEAADPSTAPTPAPLEEKKEEVEKLEAEKKAVEST PEQPEAPVENNVGHDVSTTESSTEPVKVTSPAVPSEVITASPPSAPAITEDVASVAKAIE EIDISDKAVAAATIECNTNEIIAEARYQNNINE |
 Top
| |