| Protein: 110757826 XP_001122195.1 PREDICTED: inositol monophosphatase 3-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 42.6 | 57.4 | 0.74216026 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 83.5* | 5.3 | 11.2 | 7.455357 | 0.4732143 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 18.9 | 81.1 | 0.23304562 | ||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 24.4* | 4.6* | 71 | 0.34366196 | 0.06478873 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 1* | 99 | 0.01010101 | ||
| Heart | 66 | 34 | 1.9411764 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.1 | 58.9 | 0.39219016 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASYAEDFYYEFAIKLTHDAAHILKEAINGVKKIDEKLGNWDLVTEYDRKIEDLIIGQLK TKFPDHKFIGEESIGKELPELTNDPTWIIDPIDGTTNFVHAFPHTCIVIGLAIKKEMVIG IVYNPILEQLFTARKGRGAFLNDKPIKVSKVQDLSKALVCMESGFIKIDYMREKTIERLR TIVQEVQGIRTLGVAALSLCYIAMGIVDAYYIEGPGISTWDIAAASLIISEAGGIVVDRV TGEKIDIMKPRAIGACNEKIANKMVKLIREADQKVK |
 Top
| |