| Protein: 328780496 XP_001120475.2 PREDICTED: prefoldin subunit 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.8 | 46.2 | 1.1645021 | ||
| Scape | 57.8 | 42.2 | 1.3696682 | ||
| Brain | 29.9 | 70.1 | 0.42653352 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 15.3* | 84.7 | 0.18063754 | ||
| Leg, front | |||||
| Leg, middle | 29.8 | 9.5* | 60.7 | 0.49093905 | 0.15650742 |
| Leg, rear | 63.6 | 36.4 | 1.7472527 | ||
| Mandibular gland | 3.7 | 96.3 | 0.038421597 | ||
| Rectum | |||||
| Salivary gland, cerebral | 57 | 43 | 1.3255814 | ||
| Salivary gland, thoracic | 42.5 | 24.5 | 33 | 1.2878788 | 0.74242425 |
| Sternite | 77.7 | 22.3 | 3.484305 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 69.1 | 30.9 | 2.2362459 | ||
| Malpighian tubules | 32.6 | 31.5 | 35.9 | 0.908078 | 0.87743735 |
| Nerve chord | 37.9 | 24.8 | 37.4 | 1.013369 | 0.6631016 |
| Poison sac | |||||
| Sting | |||||
| Heart | 59 | 41 | 1.4390244 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 48.2 | 27 | 48.6 | 0.99176955 | 0.5555556 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASDKKSGKSSKGTKSTTEILSEFQMLRNEQRAMANKLSEMEMELNEHKIVIDTLKNIDP KRKCYRMTGGVLCERTVEDVMPALITNKEQLIKVIDTLNDQLTKKGIEINEFKEKHNIRI RGQQDVQQRQGAVHLGC |
 Top
| |