| Protein: 328793706 XP_001121829.2 PREDICTED: uncharacterized protein C22orf25 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 90.4 | 9.6 | 9.416667 | ||
| Salivary gland, thoracic | 20.7 | 79.3 | 0.26103404 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 69.9 | 30.1 | 2.3222592 | ||
| Malpighian tubules | 26.5 | 28.5 | 45 | 0.5888889 | 0.6333333 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 1.6* | 98.4 | 0.016260164 | ||
| Heart | 13.2 | 43.8 | 43 | 0.30697674 | 1.0186046 |
| Hypopharyngeal gland | 13.7 | 86.3 | 0.15874855 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 50 | 21.7 | 56 | 0.89285713 | 0.3875 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MCILFIYRNPNANSESYRLILVANRDEYFKRAALPAHYWKNHPVCLGGIDMESGKEGGTW LGVSLTGKAGVLLNLSSLEKSSTNIPKQGRGFLVSNFIVSKHSTTSYLDQLHKENKENKE IQYNPFLLVLLNLQYVNELKKNV |
 Top
| |