| Protein: 48130977 XP_393322.1 PREDICTED: 60S ribosomal protein L18a |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.8 | 57.2 | 0.74825174 | ||
| Scape | 41.9 | 34.7 | 23.4 | 1.7905983 | 1.482906 |
| Brain | |||||
| Crop | 25.7 | 37.7 | 36.6 | 0.7021858 | 1.0300547 |
| Eye | 2.4* | 56.1 | 41.5 | 0.057831325 | 1.3518072 |
| Intestine | 12.7 | 47.8 | 39.5 | 0.321519 | 1.2101266 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 84.8 | 15.2 | 5.5789475 | ||
| Salivary gland, thoracic | 21.6 | 40.3 | 38.1 | 0.56692916 | 1.0577428 |
| Sternite | 19.4 | 40.7 | 39.9 | 0.48621553 | 1.0200502 |
| Tergite | 18.9 | 76.9* | 4.2 | 4.5 | 18.309525 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 37 | 31.2 | 31.8 | 1.163522 | 0.9811321 |
| Malpighian tubules | 35.3 | 23.6 | 41 | 0.8609756 | 0.57560974 |
| Nerve chord | 54.7 | 45.3 | 1.2075055 | ||
| Poison sac | |||||
| Sting | 54.9 | 45.1 | 1.2172949 | ||
| Heart | 20.2 | 52.3 | 27.5 | 0.73454547 | 1.9018182 |
| Hypopharyngeal gland | 13.6 | 86.4 | 0.1574074 | ||
| Galea | |||||
| Glossa | 33.1 | 66.9 | 0.49476832 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.4 | 42.5 | 40 | 0.785 | 1.0625 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKAKGELKEFEVIGRKLPTEKEKSTPLYKMRIFAPDAIVAKSRFWYFLRQLKKFKKSTGE IVSLKQIPEKSPVKIKNFGIWLRYDSRSGTHNMYREYRDLSVSGAVTQCYRDMGARHRAR AHSIQIIKVEVVKAANCRRPQVKQFHDSKIRFPLPKRIHHRNRMPLFSVRKPRTYFL |
 Top
| |