Home List proteins by tissue Protein search Downloads Links
Protein: 328792301 XP_001121760.2 PREDICTED: 28S ribosomal protein S36 mitochondrial-like
Distribution (mouse over here
Sample of a protein distribution map. for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum
Scape 21* 20.4 58.7 0.35775128 0.3475298
Brain
Crop 72* 28 2.5714285
Eye
Intestine 43.8 56.2 0.77935946
Leg, front 37.2 25.3 37.5 0.992 0.67466664
Leg, middle 38.4 20.8 40.8 0.9411765 0.50980395
Leg, rear 35.7 29 35.3 1.0113314 0.82152975
Mandibular gland 29.2 70.8 0.4124294
Rectum
Salivary gland, cerebral 24.8 75.2 0.32978722
Salivary gland, thoracic 45.8 25.4 28.8 1.5902778 0.8819444
Sternite 29.2 41.4 29.4 0.99319726 1.4081633
Tergite
Ventriculus
Thoracic muscle 25.3 74.7 0.33868808
Fat body
Malpighian tubules 48.5 27.1 24.5 1.9795918 1.1061225
Nerve chord 44.4 15.3 40.3 1.101737 0.37965262
Poison sac
Sting 65.6 34.4 1.9069767
Heart 62.5 13.9 23.6 2.6483052 0.58898306
Hypopharyngeal gland
Galea 26.6 33.8 39.6 0.67171717 0.85353535
Glossa 35.5 32.2 32.2 1.1024845 1
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 36 33.3 42.9 0.83916086 0.7762238
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MMASKGWKVVKPHVPLIKFRKGGIQKDTTSNPPSKHLDSAMLEQNNPSATGPNVVVLPTI
EDLYLPARFQRRPIDEKEIAYINRGGPE

Top