![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66551115 XP_623285.1 PREDICTED: eukaryotic initiation factor 4A-like isoform 2 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.8 | 19.8 | 41.5 | 0.93493974 | 0.47710845 |
| Scape | 49.5 | 20.3 | 30.2 | 1.6390729 | 0.6721854 |
| Brain | 84.1* | 15.9 | 5.289308 | ||
| Crop | 40.8 | 24.4 | 34.9 | 1.1690544 | 0.6991404 |
| Eye | |||||
| Intestine | 33.6 | 30.2 | 36.2 | 0.9281768 | 0.83425415 |
| Leg, front | 33 | 31.4 | 35.6 | 0.9269663 | 0.8820225 |
| Leg, middle | 35.1 | 34.7 | 30.2 | 1.1622517 | 1.1490066 |
| Leg, rear | 44.5 | 30.3 | 25.3 | 1.7588933 | 1.1976285 |
| Mandibular gland | 29.4 | 70.6 | 0.4164306 | ||
| Rectum | |||||
| Salivary gland, cerebral | 76.4 | 5.2 | 18.4 | 4.152174 | 0.2826087 |
| Salivary gland, thoracic | 42.2 | 21.6 | 36.3 | 1.1625345 | 0.59504133 |
| Sternite | |||||
| Tergite | 93.9 | 6.1 | 15.393442 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.9 | 26.7 | 31.4 | 1.3343949 | 0.8503185 |
| Malpighian tubules | 30.7 | 38.3 | 31.1 | 0.9871383 | 1.2315112 |
| Nerve chord | 44.9 | 26.8 | 28.3 | 1.5865724 | 0.94699645 |
| Poison sac | |||||
| Sting | 58.7 | 41.3 | 1.4213076 | ||
| Heart | 33.2 | 36.5 | 30.3 | 1.0957096 | 1.2046205 |
| Hypopharyngeal gland | 26.9 | 73.1 | 0.36798906 | ||
| Galea | 43.8 | 56.2 | 0.77935946 | ||
| Glossa | 31.9 | 68.1 | 0.4684288 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.5 | 32.9 | 37 | 1.2027028 | 0.8891892 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSHTSERRNDDQWAGDSKNGPSESDQQTYDGPPGMEPDGIIESNWDVVVDNFDEMNLKEE LLRGIYAYGFEKPSAIQQRAILPCIRGHDVIAQAQSGTGKTATFSISILQQIDTTIKECQ ALILAPTRELAQQIQKVVIALGDFMHAECHACIGGTNVREDMRKLDQGVHIVVGTPGRVY DMISRRALRASSIKLFVLDEADEMLSRGFKDQIHDVFKLLPHEVQVILLSATMPSDVLDV SKCFMRNPIRILVKKEELTLEGIKQFFIYVEREEWKFETLCDLYDTLSITQAVIFCNTRR KVDWLTESMRTRDFTVSAMHGDMEQKERDLIMRQFRTGSSRVLITTDLLARGIDVQQVSL VINYDLPSNRENYIHRIGRGGRFGRKGVAINLVTDDDKRTLKDIEQFYNTSIEEMPMNVA DLI |
|
| |