| Protein: 328786736 XP_624450.2 PREDICTED: probable hydroxyacid-oxoacid transhydrogenase mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.4 | 70.6 | 0.4164306 | ||
| Scape | 68 | 32 | 2.125 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 33.7 | 27.3 | 38.9 | 0.8663239 | 0.7017995 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 87.7 | 12.3 | 7.130081 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 3.4* | 76.3* | 20.3 | 0.16748768 | 3.7586207 |
| Sternite | |||||
| Tergite | 51.3 | 48.7 | 1.0533881 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 10.7 | 51.4 | 37.9 | 0.2823219 | 1.3562006 |
| Malpighian tubules | 23.5 | 37.4 | 39.1 | 0.601023 | 0.95652175 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 58.1 | 41.9 | 1.3866348 | ||
| Heart | 24.6 | 42.7 | 32.7 | 0.7522936 | 1.3058105 |
| Hypopharyngeal gland | 86.3 | 13.7 | 6.29927 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.4 | 55.4 | 35.3 | 0.8611898 | 1.5694051 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTNATLTKEYAFEMTSPILRYGIGVTRELGMDMQNFGSKNVCLMTDSNLVNLPPVKTAIN SLIKYKNQTTVYDNVHVEPTDQSLKDCIEFVKFKNFDGFVAIGGGSVIDTCKVANLYSSD PQADFLDYVNAPIGKEKPITIQLKPLVAVPTTFGTGSETSGICIFSYEPLKTKIGIINRA LRPTLGLIDPNHTLSLPERVCAYSGFDVLCNALESFTALPYTERTCPSNPNLRPAYQGSN PISDVWSKFTLQIMHKYFKRAVYNQDDIEARSNMHLASTMAGVGFGNAGVHLCHALSYPI SGYAKSFQPTDYGKGRTIVPHGLSVVITAPAVFSFTGSACPEKHLEAAELLGTDISQAKK SDAGKILGDTIRKYMQIMKIENGLTELGFTKKDIPFLVEGALQQQRLTKLAPREHSREDL AQIFENSFRIY |
 Top
| |