| Protein: 48102954 XP_392826.1 PREDICTED: small ubiquitin-related modifier-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.7 | 37.8 | 29.6 | 1.1047298 | 1.277027 |
| Scape | 30.1 | 40.1 | 29.9 | 1.006689 | 1.3411372 |
| Brain | 43.4 | 56.6 | 0.7667844 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 61.8 | 38.2 | 1.6178011 | ||
| Leg, front | 31.8 | 41.4 | 26.8 | 1.1865672 | 1.5447761 |
| Leg, middle | 23.9 | 50.7 | 25.4 | 0.9409449 | 1.996063 |
| Leg, rear | 33.2 | 42.5 | 24.3 | 1.3662552 | 1.7489712 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 37.4 | 28.3 | 34.4 | 1.0872093 | 0.8226744 |
| Sternite | 25.9 | 42.2 | 31.9 | 0.81191224 | 1.322884 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 72.8 | 27.2 | 2.6764705 | ||
| Malpighian tubules | 24.2 | 46.7 | 29 | 0.8344827 | 1.6103449 |
| Nerve chord | 35 | 36.6 | 28.4 | 1.2323943 | 1.2887324 |
| Poison sac | |||||
| Sting | 78.9* | 21.1 | 3.7393365 | ||
| Heart | 32.1 | 42.6 | 25.2 | 1.2738096 | 1.6904762 |
| Hypopharyngeal gland | |||||
| Galea | 17.4 | 47.7 | 35 | 0.49714285 | 1.3628571 |
| Glossa | 22.2 | 50.4 | 27.4 | 0.810219 | 1.839416 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.3 | 45 | 30.6 | 1.120915 | 1.4705882 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDNQEQKPEAGPGDANSEYIKLKVVGNDSNEIHFRVKMTTQMGKLKKSYSDRVGVPMTS LRFLFDGKRINDDETPKQLEMENDDVIEVYQEQTGGHY |
 Top
| |