Home List proteins by tissue Protein search Downloads Links
Protein: 328787101 XP_623673.3 PREDICTED: isocitrate dehydrogenase [NADP] cytoplasmic isoform 2
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 36 31.3 32.7 1.1009175 0.9571865
Scape 24.7 43.1 32.2 0.7670807 1.3385093
Brain 62.4 37.6 1.6595745
Crop 21.8 36.3 41.9 0.5202864 0.86634845
Eye 26 39.7 34.3 0.7580175 1.1574343
Intestine 45.3 28.9 25.8 1.755814 1.1201551
Leg, front 27.6 45 27.4 1.0072993 1.6423358
Leg, middle 28 43.9 28.1 0.9964413 1.5622776
Leg, rear 55.3 28.4 16.2 3.4135802 1.7530864
Mandibular gland 56.4 43.6 1.293578
Rectum 17.3 46 36.8 0.4701087 1.25
Salivary gland, cerebral 93.5* 2.8 3.6 25.972221 0.7777778
Salivary gland, thoracic 20.8 42.3 36.9 0.56368566 1.1463414
Sternite 20.9 49.4 29.7 0.7037037 1.6632997
Tergite 15.4 60.5 24.1 0.6390042 2.5103734
Ventriculus 25.3 31.8 42.9 0.5897436 0.74125874
Thoracic muscle 10.7 57.3 32 0.334375 1.790625
Fat body 28.3 31.9 39.9 0.70927316 0.79949874
Malpighian tubules 24.4 41.3 34.4 0.7093023 1.2005814
Nerve chord 21.8 59.4 18.8 1.1595745 3.1595745
Poison sac
Sting 53.8 46.2 1.1645021
Heart 16.5 50.5 33 0.5 1.530303
Hypopharyngeal gland 76.7 23.3 3.2918456
Galea 29 40 31 0.9354839 1.2903225
Glossa 24 42.2 33.8 0.71005917 1.2485207
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 30.4 43.5 31.4 0.9681529 1.3853503
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MFFCHHLNKANVHFIRRAYIKSYSNNIFSSQILLPKIHQSFNNSTFLFVKTFSNISSITM
TKIQVGPVVDVLGDEMTRVIWDSIKEKLILPYLDIKLHTYDLSIENRDATNDNVTVECAE
AIKKYNVGIKCATITPDEKRVKEFNLKKMWKSPNGTIRNILGGTVFREPIICKNIPKLVN
SWIRPIIIGRHAHADQYKAVDFIIPGPGKLEITWIGDNEQKIQHIVHNFKGPGIAQAQYN
TDESIHAFAHSSFQYALSRNYPLYLSTKNTILKQYDGKFKDIFHEIYEKEYKAQFEAKNI
WYEHRLIDDMVAYAMKSDGGFVWSCKNYDGDVQSDSVAQGYGSLGLMTSVLICPDGRTVE
AEAAHGTVTRHYRQYQQGKETSTNPIASIFAWTRGLLHRAKLDDNKDLKQFSETLEAVCI
NTIESGFMTKDLAICIKGMNNVTRSDYLETFEFIDKLAENLQKQIKVN

Top