![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328784969 XP_003250527.1 PREDICTED: leucine-rich repeats and immunoglobulin-like domains protein 3-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 96.1* | 3.9 | 24.641026 | ||
| Scape | 12.6 | 74.1* | 13.3 | 0.94736844 | 5.571429 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 80.6* | 19.4 | 4.1546392 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 92.5* | 7.5 | 12.333333 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 0.7* | 77.6* | 21.8 | 0.03211009 | 3.559633 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 90.2* | 9.8 | 9.204082 | ||
| Heart | 93* | 7 | 13.285714 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.3 | 87.2 | 11.8 | 2.6525424 | 7.3898306 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIQYKTVLFILILTIVKSKCSPKISWVPNIIKENLDKIILDKQSFVTCSQEEIVNLKGLN LNDIPTELIKSKTIQAISLENNEISVVPKDIFYKIPNLQCLDLARNKILADDLEMKHDRL KTLILDYQKTLTNNDIFLPIKIKGRFPNLETLSWKNLKNDILTVEASFPRINNIYLSDSN LKYIYDNITSIFPYLKNIHLENNLIDQLVEYDFKNVEELYLDNNPLYYLSFNPKFTKNLK ILSLSNITYNIPTLNIPSLITLDLSENRLHFPSDNIFEYTLFLENLILSKNEFTKFPNLT SLNNLKKLSLAYNIITNVKDISVAKSLKMLSLRGNMIYNIDKKAFFKFTELEFLDLSENK LQSLPFGWNKNLSMLKYLNLESNYFQNIEGMMLNSLFTLQKLYIKNNDIMSLDLNISNIK IIPQNCTVYLF |
|
| |