| Protein: 296010819 NP_001171540.1 catalase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.8 | 24 | 50.3 | 0.51292247 | 0.47713718 |
| Scape | 21.1 | 31.8 | 47.1 | 0.44798303 | 0.6751592 |
| Brain | |||||
| Crop | 40.1 | 14.7 | 45.3 | 0.88520974 | 0.3245033 |
| Eye | |||||
| Intestine | 43.5 | 21.2 | 35.3 | 1.2322946 | 0.60056657 |
| Leg, front | 15.4* | 14.3* | 70.3 | 0.21906117 | 0.20341393 |
| Leg, middle | 14* | 11.9* | 74 | 0.1891892 | 0.16081081 |
| Leg, rear | 72.8 | 5.2* | 22 | 3.3090909 | 0.23636363 |
| Mandibular gland | 20.2 | 34.9 | 44.9 | 0.44988865 | 0.77728283 |
| Rectum | 35.6 | 17.7 | 46.7 | 0.76231265 | 0.379015 |
| Salivary gland, cerebral | 94.1 | 5.9 | 15.949153 | ||
| Salivary gland, thoracic | 27.6 | 30.8 | 41.6 | 0.66346157 | 0.74038464 |
| Sternite | 8.5 | 7.2* | 84.3 | 0.10083037 | 0.085409254 |
| Tergite | 3.8 | 1.8* | 94.4 | 0.040254235 | 0.019067798 |
| Ventriculus | 20.7 | 44.1 | 35.2 | 0.5880682 | 1.2528409 |
| Thoracic muscle | |||||
| Fat body | 9.3 | 5.7* | 85 | 0.10941177 | 0.067058824 |
| Malpighian tubules | 38.8 | 8.5* | 52.7 | 0.7362429 | 0.16129032 |
| Nerve chord | 27.3 | 32.4 | 40.3 | 0.67741936 | 0.8039702 |
| Poison sac | |||||
| Sting | 45 | 55 | 0.8181818 | ||
| Heart | 17.9 | 12.7* | 69.4 | 0.25792506 | 0.18299712 |
| Hypopharyngeal gland | 6.5 | 93.5 | 0.069518715 | ||
| Galea | 41.8 | 58.2 | 0.7182131 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.4 | 19.5 | 54.8 | 0.55474454 | 0.3558394 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTEIKRNPSADQLIDYKKNLKPDCPIFLTGSGTPISKKASLTVGPNGPILLQDYVFLDEL SHFNRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFSSIGKRTPIAVRFSTVGGESG SADTVRDPRGFAVKFYTEEGVWDLVGNNTPIFFIKDPIYFPSFIHTQKRNPVTHLKDADM FWDFLSLRPESTHQVMFLFSDRGIPDGYRHMNGYGSHTFSLVNAKDEIVYCKFHYKTDQG IKNLPVDKAGELSASNPDYAIQDLYDAIAKNQYPTWTFYIQVMTPTQAKSFKWNPFDLTK VWPHDEYPLIPVGKLVLNRNPENYFADIEQIAFDPAHMVPGIGASPDKMLQGRMFTYGDA HRHRLGPNNLQLPVNCPFKEISVINYQRDGQATINNQNGAPNYFPNSFGGPRECPAVAPP TYFVSGDVGRYDVDPKEDNFGQVTLFWRNVLDDKEKSRLVNNLVQNLSNASMFIVERAVK NFTQVDADLGLRLTEGLRNKGVLINRYGKTARL |
 Top
| |