| Protein: 66513180 XP_623441.1 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.1 | 29.6 | 31.4 | 1.2452229 | 0.9426752 |
| Scape | 24.8 | 20.6 | 54.6 | 0.45421246 | 0.37728938 |
| Brain | 44.2 | 55.8 | 0.7921147 | ||
| Crop | 35.4 | 33 | 31.7 | 1.1167192 | 1.0410094 |
| Eye | 57.8 | 42.2 | 1.3696682 | ||
| Intestine | 47.4 | 52.6 | 0.9011407 | ||
| Leg, front | 7.2* | 47.8 | 45 | 0.16 | 1.0622222 |
| Leg, middle | 24.2 | 56.6 | 19.1 | 1.2670157 | 2.9633508 |
| Leg, rear | 17.9 | 36.1 | 46 | 0.38913044 | 0.7847826 |
| Mandibular gland | 44.1 | 16 | 39.9 | 1.1052631 | 0.4010025 |
| Rectum | |||||
| Salivary gland, cerebral | 14.4 | 45 | 40.6 | 0.3546798 | 1.1083744 |
| Salivary gland, thoracic | 36.3 | 35.7 | 28 | 1.2964286 | 1.275 |
| Sternite | 29.2 | 34.1 | 36.7 | 0.79564035 | 0.9291553 |
| Tergite | 23.4 | 31.3 | 45.3 | 0.51655626 | 0.6909492 |
| Ventriculus | |||||
| Thoracic muscle | 31 | 39.4 | 29.6 | 1.0472972 | 1.331081 |
| Fat body | 34.7 | 47.6 | 17.7 | 1.960452 | 2.6892655 |
| Malpighian tubules | 42.1 | 29.5 | 28.4 | 1.4823943 | 1.0387324 |
| Nerve chord | 39.1 | 31.9 | 29 | 1.3482759 | 1.1 |
| Poison sac | |||||
| Sting | 23.4 | 76.6 | 0.30548304 | ||
| Heart | 51.6 | 19.6 | 28.7 | 1.7979094 | 0.68292683 |
| Hypopharyngeal gland | 87.4 | 12.6 | 6.9365077 | ||
| Galea | 41.4 | 24.6 | 34 | 1.2176471 | 0.7235294 |
| Glossa | 49 | 19.1 | 31.9 | 1.5360502 | 0.59874606 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.8 | 36.4 | 37.3 | 0.9061662 | 0.9758713 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MATPLKATVKQVKPILSLTPIEARRRVISLYKTWYRQIPFILSNYDLPRTKKECQQKLKE EFKRNAHISDLRVIDLLLIKGQMELQEVCAQWKPPGTLLNYWKETHEPKPKDFMSKFLSG QD |
 Top
| |