| Protein: 110763879 XP_625293.2 PREDICTED: hypothetical protein LOC552675 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.5 | 31.4 | 23.2 | 1.9612069 | 1.3534483 |
| Scape | 23.5 | 44.5 | 32 | 0.734375 | 1.390625 |
| Brain | |||||
| Crop | 45.2 | 54.8 | 0.82481754 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 37.7 | 27.3 | 35 | 1.0771428 | 0.78 |
| Leg, middle | 35.1 | 29.6 | 35.3 | 0.9943343 | 0.8385269 |
| Leg, rear | 42.2 | 33.2 | 24.6 | 1.7154472 | 1.3495935 |
| Mandibular gland | 3.9 | 96.1 | 0.040582728 | ||
| Rectum | |||||
| Salivary gland, cerebral | 49.6 | 4.7 | 45.8 | 1.0829694 | 0.10262009 |
| Salivary gland, thoracic | 34.5 | 29.5 | 36 | 0.9583333 | 0.8194444 |
| Sternite | 31 | 31.4 | 37.7 | 0.8222812 | 0.8328912 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 79.4 | 20.6 | 3.854369 | ||
| Malpighian tubules | 32.9 | 48 | 19.1 | 1.7225131 | 2.513089 |
| Nerve chord | 28 | 49.1 | 22.9 | 1.2227074 | 2.1441047 |
| Poison sac | |||||
| Sting | 43.4 | 56.6 | 0.7667844 | ||
| Heart | 22.5 | 58.6* | 19 | 1.1842105 | 3.0842106 |
| Hypopharyngeal gland | 24.3 | 75.7 | 0.32100397 | ||
| Galea | |||||
| Glossa | 46.6 | 27.1 | 26.3 | 1.7718631 | 1.0304183 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.6 | 35.1 | 38.9 | 0.94087404 | 0.90231365 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSEIKAENKNDNNIEDVSKDHSAEEKPSPTKNKRGGTKRLSTLERLAQEGERVTKDLNAS VGEVEGRRRTRSSARGLTSSTPVPSPPKKEKRDTSTKGTGRGRGRPKRQEKNNDNNTDEE AANNKSEKHSEEESMKMDVDEHKEETEKLADSEDKGVTKLESKEAIEKTLDTNFKEEKVA EESENFAEESKSSSISEEKKEEDIKDSSDSSQDATDTTTEAPPSSSSESQNLSNTTTTEE NKE |
 Top
| |