| Protein: 328777827 XP_624255.2 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.8 | 35.4 | 31.9 | 1.0282131 | 1.1097178 |
| Scape | 45 | 20.9 | 34.2 | 1.3157895 | 0.6111111 |
| Brain | 46.1 | 53.9 | 0.85528755 | ||
| Crop | 26.1 | 47.9 | 26 | 1.0038462 | 1.8423077 |
| Eye | 50.5 | 49.5 | 1.020202 | ||
| Intestine | 40.9 | 25.3 | 33.8 | 1.2100592 | 0.74852073 |
| Leg, front | 24.5 | 33.2 | 42.3 | 0.5791962 | 0.78486997 |
| Leg, middle | 39.4 | 33.2 | 27.3 | 1.4432235 | 1.2161173 |
| Leg, rear | 26.2 | 24.3 | 49.5 | 0.52929294 | 0.4909091 |
| Mandibular gland | 61.8 | 38.2 | 1.6178011 | ||
| Rectum | |||||
| Salivary gland, cerebral | 18.7 | 35.6 | 45.7 | 0.4091904 | 0.7789934 |
| Salivary gland, thoracic | 29.1 | 43.9 | 27 | 1.0777777 | 1.6259259 |
| Sternite | 35 | 25.1 | 40 | 0.875 | 0.6275 |
| Tergite | 34.9 | 22.7 | 42.4 | 0.8231132 | 0.5353774 |
| Ventriculus | |||||
| Thoracic muscle | 12.9 | 74.4 | 12.7 | 1.015748 | 5.858268 |
| Fat body | 32.2 | 47.1 | 20.7 | 1.5555556 | 2.2753623 |
| Malpighian tubules | 42.3 | 23.7 | 33.9 | 1.2477876 | 0.69911504 |
| Nerve chord | 31.6 | 29.2 | 39.2 | 0.8061224 | 0.74489796 |
| Poison sac | |||||
| Sting | 27.9 | 72.1 | 0.38696256 | ||
| Heart | 49.3 | 17.8 | 32.9 | 1.4984802 | 0.54103345 |
| Hypopharyngeal gland | 90.5 | 9.5 | 9.526316 | ||
| Galea | 35.5 | 46.1 | 18.4 | 1.9293479 | 2.5054348 |
| Glossa | 41.1 | 16.3 | 42.6 | 0.96478873 | 0.3826291 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.7 | 37.1 | 35.8 | 0.96927375 | 1.0363128 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLNIFLQLILPHRCDHYHIRELKVGGDLGQVLYHPFDLRDEESIIRTIKYSNVVINLIGS NYETRNFSFEDVHVEGARTLAKLAKQCNVERFIHMSCLNVEEKPTPIILKESSKILKTKW KGELAVKEEFPEATIIRPSVIYGHKDKFINHYMDQNRLNSNRLPLWDKGEKTEKQPVSIH DVISGIVAIVRNSDTVGKTYQFVGPKRYKLNELVKWMFDIKLKYFKNNIKIVDMKYDPYA WLKTSLREYIYAVHPTTDMLWEVLECHHISDKIDSALPTLEDLGITPIDLQTRIEWEITP YIENKMEIEDLQRIIPPTVKSIPK |
 Top
| |