| Protein: 110758129 XP_392465.3 PREDICTED: RNA-binding protein squid-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.9 | 22.1 | 38 | 1.05 | 0.58157897 |
| Scape | 36 | 27.3 | 36.8 | 0.9782609 | 0.7418478 |
| Brain | |||||
| Crop | 37 | 33.3 | 29.7 | 1.2457912 | 1.1212121 |
| Eye | |||||
| Intestine | 28.2 | 36.9 | 35 | 0.8057143 | 1.0542858 |
| Leg, front | 32 | 44.8 | 23.3 | 1.3733906 | 1.9227468 |
| Leg, middle | 48 | 52 | 0.9230769 | ||
| Leg, rear | |||||
| Mandibular gland | 41.7 | 58.3 | 0.71526587 | ||
| Rectum | 76.6 | 23.4 | 3.2735043 | ||
| Salivary gland, cerebral | 55.4 | 13 | 31.6 | 1.7531645 | 0.4113924 |
| Salivary gland, thoracic | 34.8 | 23.9 | 41.3 | 0.842615 | 0.5786925 |
| Sternite | 17.9 | 37.5 | 44.6 | 0.40134528 | 0.8408072 |
| Tergite | 47.1 | 52.9 | 0.89035916 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 46.3 | 36.7 | 16.9 | 2.739645 | 2.1715977 |
| Malpighian tubules | 31.4 | 33.6 | 35 | 0.8971428 | 0.96 |
| Nerve chord | 38.3 | 16.3 | 45.3 | 0.8454746 | 0.3598234 |
| Poison sac | |||||
| Sting | 54 | 46 | 1.173913 | ||
| Heart | 33 | 34.9 | 32 | 1.03125 | 1.090625 |
| Hypopharyngeal gland | 37.4 | 62.6 | 0.5974441 | ||
| Galea | 36.2 | 31.5 | 32.4 | 1.1172839 | 0.9722222 |
| Glossa | 30.7 | 32 | 37.2 | 0.8252688 | 0.86021507 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.3 | 34.8 | 38.7 | 0.9638243 | 0.8992248 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADQENKDFSEDIADQNFEQNGEAENGGGDAAENGQESQEERSTGGNQDSLNDRKLFVGG LSWETTDKELRDHFGTYGDIESINVKTDPNTGRSRGFAFIVFAKAESLDKIMAAGDHVIN NKKVDPKKAKARHGKIFVGGLSTELSDDDIKNFFSQFGTIVEVEMPFDKTKNQRKGFCFI TFESEQVVNELLKTPKQTINGKEVDVKKATPKPDGMGGMRGGAGGRGGRGGRGGRGRGFG GQGGWGQGGYGGGYGGGYGQGGYGGGYDGYGGGYDYYGGGYGGYGGYDYSGYDGYGYGGG SYDGGYSGGRGGARGKGFLSHHSLNHHSIKPRHFQQDFQQRRLLPQNKMNHQESRQKL |
 Top
| |