| Protein: 328786659 XP_624372.2 PREDICTED: putative deoxyribose-phosphate aldolase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 79.1* | 20.9 | 3.784689 | ||
| Leg, middle | 24 | 63.8* | 12.2 | 1.9672132 | 5.2295084 |
| Leg, rear | 83.4 | 8.6 | 8 | 10.425 | 1.075 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 1.4 | 34.9 | 63.7 | 0.021978023 | 0.5478807 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 7.1 | 18 | 74.9 | 0.09479306 | 0.24032043 |
| Malpighian tubules | 35.9 | 27.8 | 36.3 | 0.9889807 | 0.76584023 |
| Nerve chord | 76.8 | 23.2 | 3.310345 | ||
| Poison sac | |||||
| Sting | 37.7 | 62.3 | 0.60513645 | ||
| Heart | 1.9* | 38.3 | 59.8 | 0.031772576 | 0.64046824 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.2 | 38.2 | 40.2 | 0.82587063 | 0.9502488 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNIQKLTNATMNFDQSAIDEKINSIRSRVYKLEKHVKTTWLIKAIGFLDLTTLGSDDTPA KIEALCDKAVHPFKLSNNSNLHTASVYVYPLRLMDAITALEKLDKDHKISRATVGGGFPS GQYLLETRLREVELDVELGADEIDIVINRPLVLMHQWQKLYEELKLFRTACGNKCLKVIL GTGELGNLENVYKASMIAMMAGADFIKTSTGKEAINATLPVGIVMCRAIKDYYESTQKKV GLKPAGGIKAPQEALEWMMLVQMELGEEWLCKDFFRIGSSNLLDNIIEEIQSN |
 Top
| |