| Protein: 48105889 XP_393034.1 PREDICTED: 60S ribosomal protein L7a |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.5 | 59.5 | 0.6806723 | ||
| Scape | 46.4 | 23.7 | 29.9 | 1.5518395 | 0.7926421 |
| Brain | |||||
| Crop | 22.8 | 38.7 | 38.5 | 0.5922078 | 1.0051948 |
| Eye | 68.3 | 31.7 | 2.1545742 | ||
| Intestine | 13.9 | 46.4 | 39.7 | 0.35012594 | 1.1687658 |
| Leg, front | |||||
| Leg, middle | 29.6 | 70.4 | 0.42045453 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 65.1 | 11.2 | 23.7 | 2.7468355 | 0.47257385 |
| Salivary gland, thoracic | 42.4 | 14.1 | 43.5 | 0.97471267 | 0.32413793 |
| Sternite | 46.2 | 44.5 | 9.3 | 4.967742 | 4.7849464 |
| Tergite | 12.7 | 81.2* | 6.1 | 2.081967 | 13.311476 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.2 | 31.7 | 37 | 0.84324324 | 0.85675675 |
| Malpighian tubules | 32.1 | 25.9 | 42 | 0.76428574 | 0.6166667 |
| Nerve chord | 47.6 | 14.1 | 38.2 | 1.2460732 | 0.36910996 |
| Poison sac | |||||
| Sting | 51.8 | 48.2 | 1.0746888 | ||
| Heart | 9.9 | 56.3 | 33.8 | 0.2928994 | 1.6656805 |
| Hypopharyngeal gland | 14.5 | 85.5 | 0.16959064 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.7 | 37 | 39.8 | 0.8467337 | 0.9296482 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVQKKPKKKVGKKVAAAPLAVKKVEPKKQTNPLFEKRTRNFGIGQDIQPARDLSRFVKWP KYIRIQRQRAVLQKRLKVPPPINQFTQTLDKQTATQLFKMLEKYRPESAAMKKMRLKARA EQKVAKKEDTPTKKPNVLRSGTNTVTTLVEQKKAQLVVIAHDVDPIEIVLFLPALCRKMG VPYCIIKGKSRLGRLVRRKTCTAVALVQVDSGDRANFAKLVEAIKTNFNDRYDEIRRHWG GGLLGSKSAARIAKLEKAKAKELAQKQG |
 Top
| |