| Protein: 328791014 XP_003251503.1 PREDICTED: ADP-ribosylation factor 1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.2 | 9.8* | 43 | 1.0976744 | 0.22790697 |
| Scape | 40 | 24.2 | 35.8 | 1.1173184 | 0.67597765 |
| Brain | 18.1 | 32.1 | 49.8 | 0.3634538 | 0.64457834 |
| Crop | 50.5* | 33.6 | 15.9 | 3.1761007 | 2.1132076 |
| Eye | |||||
| Intestine | 31 | 37.8 | 31.2 | 0.99358976 | 1.2115384 |
| Leg, front | 20.4 | 42.1 | 37.5 | 0.544 | 1.1226667 |
| Leg, middle | 5.2* | 53.3 | 41.5 | 0.12530121 | 1.2843374 |
| Leg, rear | 43.5 | 32 | 24.5 | 1.7755102 | 1.3061224 |
| Mandibular gland | 12.5 | 87.5 | 0.14285715 | ||
| Rectum | |||||
| Salivary gland, cerebral | 83.1 | 16.9 | 4.9171596 | ||
| Salivary gland, thoracic | 37.6 | 28.7 | 33.7 | 1.115727 | 0.85163206 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 46.4 | 53.6 | 0.86567163 | ||
| Thoracic muscle | |||||
| Fat body | 51.1 | 28.9 | 20 | 2.555 | 1.445 |
| Malpighian tubules | 20.2 | 58.7* | 21.1 | 0.95734596 | 2.7819905 |
| Nerve chord | 21.9 | 54.4 | 23.7 | 0.9240506 | 2.2953587 |
| Poison sac | |||||
| Sting | 47 | 53 | 0.8867925 | ||
| Heart | 21.7 | 58.2* | 20.1 | 1.079602 | 2.8955224 |
| Hypopharyngeal gland | 21.9 | 78.1 | 0.28040972 | ||
| Galea | |||||
| Glossa | 40.7 | 59.3 | 0.68634063 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.8 | 37.5 | 39.3 | 0.8854962 | 0.9541985 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGNMFATLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAV LLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLKNA NR |
 Top
| |