| Protein: 110768336 XP_001121930.1 PREDICTED: 60S ribosomal protein L11-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42 | 58 | 0.7241379 | ||
| Scape | 40.7 | 24.4 | 34.9 | 1.1661891 | 0.6991404 |
| Brain | |||||
| Crop | 16.5 | 51.1 | 32.4 | 0.5092593 | 1.5771605 |
| Eye | 49.2 | 50.8 | 0.96850395 | ||
| Intestine | 19.6 | 44.4 | 36 | 0.54444444 | 1.2333333 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 42.5 | 57.5 | 0.73913044 | ||
| Salivary gland, cerebral | 86.5 | 13.5 | 6.4074073 | ||
| Salivary gland, thoracic | 41.5 | 16 | 42.4 | 0.9787736 | 0.3773585 |
| Sternite | 22 | 49.8 | 28.3 | 0.7773852 | 1.7597173 |
| Tergite | 19.6 | 71.7 | 8.6 | 2.2790697 | 8.33721 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 25.5 | 38.8 | 35.7 | 0.71428573 | 1.0868348 |
| Malpighian tubules | 36.1 | 27.3 | 36.6 | 0.9863388 | 0.74590164 |
| Nerve chord | 54.7 | 45.3 | 1.2075055 | ||
| Poison sac | |||||
| Sting | 50.7 | 49.3 | 1.0283976 | ||
| Heart | 19.3 | 45.5 | 35.2 | 0.54829544 | 1.2926136 |
| Hypopharyngeal gland | 4.6 | 95.4 | 0.04821803 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.7 | 39.9 | 41.2 | 0.842233 | 0.9684466 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADSKKSSEKKVEKRIEKKVRKEPKDASKNIMREVRIRKLCLNICVGESGDRLTRAAKVL EQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRKENFS GTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFNVAHRRRKTGKVGFQHRLTKE DAMKWFQQKYDGIIIAGKK |
 Top
| |