| Protein: 66518140 XP_393166.2 PREDICTED: proteasome inhibitor PI31 subunit-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 5.8* | 94.2 | 0.061571125 | ||
| Scape | 27.8 | 37 | 35.2 | 0.78977275 | 1.0511364 |
| Brain | |||||
| Crop | 37.3 | 62.7 | 0.5948963 | ||
| Eye | |||||
| Intestine | 24.7 | 34.4 | 40.9 | 0.603912 | 0.8410758 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 43.7 | 20.7 | 35.7 | 1.2240896 | 0.57983196 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 76.8 | 9.6 | 13.6 | 5.647059 | 0.7058824 |
| Malpighian tubules | 29 | 38.1 | 32.9 | 0.88145894 | 1.1580547 |
| Nerve chord | 23.2 | 41.9 | 34.9 | 0.6647564 | 1.2005731 |
| Poison sac | |||||
| Sting | 52 | 48 | 1.0833334 | ||
| Heart | 20.1 | 43.6 | 36.3 | 0.553719 | 1.2011019 |
| Hypopharyngeal gland | 77.5 | 22.5 | 3.4444444 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.4 | 39.2 | 41.6 | 0.7548077 | 0.9423077 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVDTNNIFGFELFQEIYNKQITKKEDLLILFIHWYLIKQGFRCIGIGDSKVFEPSEKGSQ LLPEGWNMQPSYTLRYINNGKLFIFHGIKSDEDLLVNLLKIHDQKVSTIQFPINQTINDL HGTLEVIIPSYQNIINIIQTDIIDTLIPSNTTENSTQTIYNTPGDDSLRGDPLRVLPQSS FASSQWRPAADPTNIGAADLNPLGRGGGMIFDPFSSQRNPIDPYRPALGVPGRLPSGAVP PFARFDPFGPPDLDRPRPRRDPDNDHLPPPGYNDMFM |
 Top
| |