| Protein: 66532125 XP_397589.2 PREDICTED: eukaryotic translation initiation factor 3 subunit J isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 31.1 | 27.5 | 41.4 | 0.7512077 | 0.6642512 |
| Brain | |||||
| Crop | 35.7 | 22.9 | 41.4 | 0.8623188 | 0.5531401 |
| Eye | |||||
| Intestine | 19.6 | 39.1 | 41.3 | 0.47457626 | 0.9467312 |
| Leg, front | 41.7 | 58.3 | 0.71526587 | ||
| Leg, middle | 41.9 | 20.7 | 37.5 | 1.1173333 | 0.552 |
| Leg, rear | 75.8 | 24.2 | 3.1322315 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 21.1 | 38.4 | 40.5 | 0.52098763 | 0.94814813 |
| Sternite | 52.7 | 47.3 | 1.114165 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 59.8 | 40.2 | 1.4875622 | ||
| Nerve chord | 36.5 | 37.9 | 25.7 | 1.4202335 | 1.4747082 |
| Poison sac | |||||
| Sting | 94.1* | 5.9 | 15.949153 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 23.4 | 44 | 32.6 | 0.71779144 | 1.3496933 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.9 | 42.7 | 36.4 | 1.0412087 | 1.1730769 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDDEWDVENAEAKFDLAIRSNKWEGEDEDEDVKDSWEDVEEEKKDVEKPAEVPKAKPKPK KALAERIEEREKKARAEAERKAKEKEEALTPEERRAEQLRRQRLQEEADLRLAMETFGVT EESVLSLDTIVPNTKEEFEQYGSVLTQKLNQFAKHSEFPLFGEELIKSVALNLPSSHLKK VKTLIDNLLIEKQRIEKAEKAKKNKGKGKAKLKIEGDNTLLSEYGDYVYDDYDDFM |
 Top
| |