| Protein: 66500885 XP_623813.1 PREDICTED: 60S ribosomal protein L13a isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.9 | 56.1 | 0.7825312 | ||
| Scape | 45.3 | 31.9 | 22.8 | 1.9868422 | 1.3991228 |
| Brain | |||||
| Crop | 28.2 | 38.6 | 33.2 | 0.8493976 | 1.1626506 |
| Eye | |||||
| Intestine | 18.7 | 46.7 | 34.6 | 0.54046243 | 1.349711 |
| Leg, front | |||||
| Leg, middle | 49 | 51 | 0.9607843 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 37.4 | 13.1 | 49.5 | 0.75555557 | 0.26464647 |
| Sternite | 31.9 | 35.8 | 32.3 | 0.9876161 | 1.1083591 |
| Tergite | 53.6 | 46.4 | 1.1551725 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.1 | 32.4 | 35.5 | 0.90422535 | 0.91267604 |
| Malpighian tubules | 40 | 22.1 | 38 | 1.0526316 | 0.58157897 |
| Nerve chord | 48.8 | 13.2 | 38 | 1.2842106 | 0.34736842 |
| Poison sac | |||||
| Sting | 60.7 | 39.3 | 1.5445293 | ||
| Heart | 13.8 | 58.1 | 28.1 | 0.4911032 | 2.0676157 |
| Hypopharyngeal gland | 14.9 | 85.1 | 0.17508814 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35 | 35.4 | 42.1 | 0.8313539 | 0.8408551 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTGFSNKPILIDGRGHLLGRLAAIIAKTILQGNKVIVVRSEQLNISGNFFRNKLKFMSFL RKRCNVNPARGPFHFRAPSKILWKTVRGMIPHKTQRGKDALRRLKVYEGCPPPYDRRKRV VVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKAVVRTLENKRRVRSILEVQKRDKLKKLT KQAGQTVAKATAPYTAIINNFGYN |
 Top
| |