| Protein: 295842220 NP_001171495.1 thioredoxin peroxidase 3 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.3 | 21.6 | 43.1 | 0.8190255 | 0.5011601 |
| Scape | 24.7 | 36.4 | 38.9 | 0.6349614 | 0.93573266 |
| Brain | 31.8 | 33.3 | 34.9 | 0.9111748 | 0.95415473 |
| Crop | 19 | 46.2 | 34.9 | 0.5444126 | 1.3237822 |
| Eye | 57.2 | 42.8 | 1.3364486 | ||
| Intestine | 31 | 23.9 | 45.1 | 0.6873614 | 0.52993345 |
| Leg, front | 32.2 | 31.4 | 36.4 | 0.88461536 | 0.86263734 |
| Leg, middle | 30.2 | 34.9 | 35 | 0.86285716 | 0.99714285 |
| Leg, rear | 36.5 | 30 | 33.6 | 1.0863096 | 0.89285713 |
| Mandibular gland | 13.9 | 51.4 | 34.6 | 0.4017341 | 1.4855491 |
| Rectum | 12.5 | 37.8 | 49.7 | 0.25150904 | 0.7605634 |
| Salivary gland, cerebral | 53.9 | 22.2 | 23.9 | 2.2552302 | 0.9288703 |
| Salivary gland, thoracic | 39.5 | 27.6 | 32.9 | 1.2006079 | 0.83890575 |
| Sternite | 34 | 55 | 11 | 3.090909 | 5 |
| Tergite | 38.6 | 35.4 | 26 | 1.4846153 | 1.3615384 |
| Ventriculus | 39.9 | 40.1 | 20 | 1.995 | 2.005 |
| Thoracic muscle | 6.7 | 54.6 | 38.7 | 0.17312661 | 1.4108527 |
| Fat body | 28.9 | 46.7 | 24.4 | 1.1844262 | 1.9139345 |
| Malpighian tubules | 37.1 | 31.9 | 31 | 1.1967742 | 1.0290322 |
| Nerve chord | 22.1 | 38.6 | 39.4 | 0.5609137 | 0.97969544 |
| Poison sac | |||||
| Sting | 48.4 | 51.6 | 0.93798447 | ||
| Heart | 32.3 | 30.7 | 37 | 0.87297297 | 0.82972974 |
| Hypopharyngeal gland | 80.6 | 19.4 | 4.1546392 | ||
| Galea | 32.3 | 27.9 | 39.8 | 0.81155777 | 0.70100504 |
| Glossa | 32.2 | 27.2 | 40.6 | 0.79310346 | 0.6699507 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.4 | 38.1 | 34.6 | 0.90751445 | 1.1011561 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLRFLASLHSHTCKAVYVATSNLVKTKQPTLVKHARNFCVSSKLFSCQLQIQKPAPEFSG TAVVDGDFKEIKLSDYKGKYVVLFFYPLDFTFVCPTELIAFSEKISEFKALNTQVIGVST DSHFSHLAWTNTPRKQGGLGGNLGYPLLSDFNKEISIKYNVLLQESGIALRGLFIIDKEG ILRQLSINDLPVGRSVDETLRLIKAFQFVEKHGEVCPANWQPDSKTIKPNPKDSKQYFES VN |
 Top
| |