| Protein: 66563899 XP_392612.2 PREDICTED: d-beta-hydroxybutyrate dehydrogenase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 24.1 | 24.9 | 51 | 0.47254902 | 0.4882353 |
| Brain | |||||
| Crop | 46.4 | 25.4 | 28.2 | 1.64539 | 0.9007092 |
| Eye | |||||
| Intestine | 27.1 | 31.9 | 41 | 0.66097564 | 0.77804875 |
| Leg, front | 42.6 | 23.3 | 34.1 | 1.2492669 | 0.68328446 |
| Leg, middle | 43 | 25.5 | 31.5 | 1.3650794 | 0.8095238 |
| Leg, rear | 26.2 | 35.3 | 38.5 | 0.68051946 | 0.9168831 |
| Mandibular gland | 46.1 | 53.9 | 0.85528755 | ||
| Rectum | |||||
| Salivary gland, cerebral | 61 | 8.5 | 30.5 | 2 | 0.27868852 |
| Salivary gland, thoracic | 20 | 53.5 | 26.5 | 0.754717 | 2.018868 |
| Sternite | 52.1 | 15.1 | 32.8 | 1.5884147 | 0.46036586 |
| Tergite | 76.6 | 23.4 | 3.2735043 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 55.9 | 30.3 | 13.8 | 4.0507245 | 2.1956522 |
| Malpighian tubules | |||||
| Nerve chord | 23.1 | 76.9 | 0.30039012 | ||
| Poison sac | |||||
| Sting | 38.1 | 61.9 | 0.6155089 | ||
| Heart | 33.4 | 33 | 33.6 | 0.99404764 | 0.98214287 |
| Hypopharyngeal gland | 68.1 | 31.9 | 2.1347961 | ||
| Galea | 43.7 | 33.4 | 22.9 | 1.908297 | 1.4585153 |
| Glossa | 49.3 | 14.8 | 35.9 | 1.3732591 | 0.41225627 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.2 | 30.3 | 37.1 | 1.1644205 | 0.8167116 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPLPSGSKEPDDSQTWELAERCLLPIAFSHAIAVILATILNTLSISQTSSFVLFLLLLVI SIGFTLFYHNLKVTAAGKAILITGCDSRVGYTLSKQLDELGFTVFAGFNTKVENEEIMQK LRREASGRLHILQLDVTSEHDIHSTFLYVNENLPDGAPGLWALVHAAAWVTLGECEWVPP SVLKRSIDINFIGLARLTQVFLPLIRRSKGRVVLVSSLLARIPSPVRGIYCAVKAAVEAW GACLRLEMRRWGVDVVIVETGEYVSGNAWLKDNNSLLEQAREMWIQLDPQTRKEYGQELF QKEMLALEKYTQKIDVDITPVIRALIDGVIKTFPMRRYTPVSRKERIQALCSDYLPKPIY DILYIN |
 Top
| |