Home List proteins by tissue Protein search Downloads Links
Protein: 62526112 NP_001014993.1 elongation factor 1-alpha
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 24.6 34 41.4 0.5942029 0.82125604
Scape 31.7 33.6 34.7 0.91354465 0.9682997
Brain 40.7 29.9 29.4 1.3843538 1.0170068
Crop 34.1 31.7 34.3 0.9941691 0.92419827
Eye 39.7 60.3 0.6583748
Intestine 27.1 40 32.9 0.82370824 1.2158055
Leg, front 38.1 26.5 35.4 1.0762712 0.74858755
Leg, middle 25.4 38.3 36.2 0.7016575 1.058011
Leg, rear 35.4 35.3 29.4 1.2040817 1.2006803
Mandibular gland 48 28.6 23.4 2.0512822 1.2222222
Rectum 60.8 15.8 23.4 2.5982907 0.6752137
Salivary gland, cerebral 74.6 6.7 18.6 4.0107527 0.36021507
Salivary gland, thoracic 41.3 20.3 38.4 1.0755209 0.5286458
Sternite 41 20.4 38.6 1.0621761 0.5284974
Tergite 73.2 18.6 8.2 8.926829 2.2682927
Ventriculus 43.9 10.9 45.2 0.9712389 0.24115044
Thoracic muscle 74.3 25.7 2.8910506
Fat body 33.9 35.9 30.2 1.1225165 1.1887417
Malpighian tubules 30 31.6 38.4 0.78125 0.8229167
Nerve chord 36.8 28 35.2 1.0454545 0.79545456
Poison sac 56 44 1.2727273
Sting 57.4 42.6 1.3474178
Heart 18.1 46.5 35.4 0.51129943 1.3135593
Hypopharyngeal gland 16.7 83.3 0.2004802
Galea 29.8 26.3 43.8 0.6803653 0.6004566
Glossa 20.9 28.9 50.2 0.41633466 0.5756972
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 40.1 29.9 36.9 1.0867208 0.8102981
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
DKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT
GEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSETRFEEIKKEVSSYIKK
IGYNPAAVAFVPISGWHGDNMLEVSSKMPWFKGWTVERKEGKVEGKCLIEALDAILPPTR
PTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAGLTTEVKSVEMHHEALQ
EAVPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPKGAADFTAQVIVLNHPGQISNGYTPV
LDCHTAHIACKFADIKEKCDRRNGKTTEENPKSIKSGDAAIVMLVPSKPMCAEAFQEFPP
LGRFAVRDMRQTVAVGVIKAVTFKDAAGKVTKAAEKAQKKK

Top