| Protein: 328793022 XP_003251813.1 PREDICTED: antitrypsin-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 85.6* | 14.4 | 5.9444447 | ||
| Scape | 16.6 | 57.9 | 25.5 | 0.6509804 | 2.2705882 |
| Brain | |||||
| Crop | 68.1* | 15.5 | 16.3 | 4.177914 | 0.9509202 |
| Eye | |||||
| Intestine | 13.9 | 44.6 | 41.4 | 0.3357488 | 1.0772947 |
| Leg, front | 51.5* | 34.7 | 13.8 | 3.731884 | 2.5144928 |
| Leg, middle | 34.6 | 43.2 | 22.1 | 1.5656109 | 1.9547511 |
| Leg, rear | 34.6 | 49.2 | 16.2 | 2.1358025 | 3.0370371 |
| Mandibular gland | 4.5 | 50.1 | 45.4 | 0.09911894 | 1.1035242 |
| Rectum | |||||
| Salivary gland, cerebral | 45.2 | 22.5 | 32.3 | 1.3993808 | 0.6965944 |
| Salivary gland, thoracic | 26.9 | 18.8 | 54.2 | 0.49630997 | 0.34686348 |
| Sternite | 79.1 | 20.9 | 3.784689 | ||
| Tergite | 22.9 | 77.1 | 0.29701686 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 17.7 | 56.6 | 25.7 | 0.68871593 | 2.2023346 |
| Malpighian tubules | 41.9 | 26.2 | 31.9 | 1.3134797 | 0.8213166 |
| Nerve chord | 20.5 | 57.6 | 21.9 | 0.93607306 | 2.630137 |
| Poison sac | 37.6 | 62.4 | 0.6025641 | ||
| Sting | 61.8 | 38.2 | 1.6178011 | ||
| Heart | 22.1 | 46.3 | 31.6 | 0.6993671 | 1.4651898 |
| Hypopharyngeal gland | |||||
| Galea | 22.9 | 45.6 | 31.4 | 0.72929937 | 1.4522293 |
| Glossa | 65.7 | 34.3 | 1.9154519 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.6 | 47.3 | 32.9 | 0.89969605 | 1.43769 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSPLSADIVLAMTAYGAQGETENQFRNVLHLPSSDSLAKSGYQTLIDNLNDVKENKLLLA NKVFIGKNFGIKPIFKDLTKDYFRSATQVINFAKSMEAANIINTWVEQNTNNLIKDLITA GDLNEMTTLVLVNAVYFKGQWKNKFNPDYTKDMPFHVNKNTIKNVPTMYKQGKYKYGELS NLNAKFIVIPYKGDELNMIIILPNEIDGLTEVEKKLQNIKLSDILNQGYEQEIQLYLPKF KVESEIHLNTVLQKMGLIDAFTSHANFSGISDENIQINKVIQKAFIEVNEEGSEAAAATG IFLGTLAFRPQIPPLFFKIDKSFHFVIQCNELILFEGLILKS |
 Top
| |