| Protein: 66524972 XP_394061.2 PREDICTED: ornithine aminotransferase mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 28.8 | 57.5* | 13.7 | 2.1021898 | 4.19708 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 50 | 28.2 | 21.8 | 2.293578 | 1.293578 |
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 0.8* | 99.2 | 0.008064516 | ||
| Ventriculus | 32.3 | 32.4 | 35.3 | 0.91501415 | 0.91784704 |
| Thoracic muscle | |||||
| Fat body | 97.2* | 2.8 | 34.714287 | ||
| Malpighian tubules | 11.3 | 68.3* | 20.4 | 0.5539216 | 3.3480392 |
| Nerve chord | |||||
| Poison sac | 29.6 | 70.4 | 0.42045453 | ||
| Sting | 82* | 18 | 4.5555553 | ||
| Heart | 13.4 | 27.2 | 59.5 | 0.22521009 | 0.45714286 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.4 | 46.5 | 37.9 | 0.8812665 | 1.226913 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNSSVMRLRIFGLTKEVNIKRSLNTQELIERDDRYGGVHFKPLPVVLSKGEGVHLWDVEG KRYLDFLAGFSTVSQGHCHPRLVKIMKEQVGKLTHTSRAFYSEPHGALGEYLTKLLGWDR FLPMNTGVEAGDTAIKVARRWAYRVKKIPADQATVVFAKGNFWGRSIAALSASTDPNCYT DFGPYVPRFDKVPYNDLDALEKKFQQDETVCAFMMEPIQGEAGVVVPDDGYLKGVRKLCT KYNILWIADEIQTGLCRTGKRLAVDHEDERPDILILGKALSGGMYPVSGILADDHIMLCL ETGTHGSTFGGSPLGNRVAVEAVKILEEENLAENARKLGEIVRKTLEKLPKDIATEFRGR GLLGGLVINKDFAKGWDICLKLKEAGLLTRPAHGQILRISPPLVITKEQLEEGLDIMTTV LRNYK |
 Top
| |