Home List proteins by tissue Protein search Downloads Links
Protein: 328784314 XP_003250432.1 PREDICTED: LOW QUALITY PROTEIN: adipocyte plasma membrane-associated protein
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 37.5 27.5 35 1.0714285 0.78571427
Scape 33.7 32.5 33.8 0.9970414 0.96153843
Brain 49.8 50.2 0.9920319
Crop 49.6 24.4 26 1.9076923 0.93846154
Eye 64.2 35.8 1.7932961
Intestine 19.9 55.3 24.8 0.80241936 2.2298386
Leg, front 28.8 41.1 30.1 0.95681065 1.3654485
Leg, middle 29.5 37.4 33 0.8939394 1.1333333
Leg, rear 52.8 28.5 18.7 2.8235295 1.5240642
Mandibular gland 3.7 58.2 38.1 0.097112864 1.527559
Rectum 9.6 66.6 23.7 0.4050633 2.8101265
Salivary gland, cerebral 30.7 59.1* 10.3 2.9805825 5.737864
Salivary gland, thoracic 28.3 37.9 33.9 0.83480823 1.1179941
Sternite 8.8 26.3 64.9 0.13559322 0.40523884
Tergite 7.6 53.4 39 0.1948718 1.3692307
Ventriculus 18.6 15.3 66.1 0.28139183 0.23146747
Thoracic muscle
Fat body 12.9 27.5 59.6 0.21644296 0.4614094
Malpighian tubules 30.4 40.2 29.4 1.0340136 1.3673469
Nerve chord 15.6 53.8 30.5 0.5114754 1.7639344
Poison sac 28.5 71.5 0.3986014
Sting 41.8 58.2 0.7182131
Heart 4.2 55.8 40 0.105 1.395
Hypopharyngeal gland 27.2 72.8 0.37362638
Galea 34.8 26.9 38.3 0.9086162 0.70234984
Glossa 30.4 33 36.6 0.8306011 0.90163934
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 24.4 40.5 40 0.61 1.0125
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MGYLKSIGTVIIYIGFFLTVITFLPGIPPEVEVSEYSIKYPNTQTEFKSRLEEIQILFSG
EVNGPEDFASFNGKIYTGIHGGYVVQIEENLIKPLVKFGQKCDGLWQEEKCGRPLGLKFN
DKGELFVNDAYYGIFKVNINTREYINIVNSSEPIDGKIPKIINSLDIAKNGDIYWTDSST
DFYLYDGMYSILANPSGRLIRYNAATKKNEVLLKNLGFANGVILSDDESFVIVSETTNSR
IIKYNLKGSKAGQQEIFAEGLPGVPDNINSDKQGGFLVSLIILIDSNNPYLIQSLIPHPY
IRKMLLRLFYLIEAPFKLLXDIYPNYYSERILHALGSLNIAKCIQPNRTSVILRMDKTGK
ILDTLLMKNVSDISSAYIYNGYLWLGSPWNEYIIRVSLKQVFPDLADNNMKSLDTKEEKQ
EKPFLTVSATPNVKIEAKSTKVTAKQEEVIKSSLKSTIKAQTTQKSNSDATIPKSTTPKS
INQQSSSVSSKTSSSSSSKTSKEVMKDNLKIEKDDSKEIKKDNFNSQIKSETLKKASNEI
KKDNSKTKHEIPNKNNEAKMKSNQPVKKDIYETQFGKSKLVKKDDNSNKK

Top