| Protein: 110756698 XP_001120847.1 PREDICTED: phospholipid hydroperoxide glutathione peroxidase mitochondrial isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.4 | 39.3 | 29.3 | 1.0716723 | 1.3412969 |
| Scape | 22.3 | 33.4 | 44.3 | 0.503386 | 0.75395036 |
| Brain | 45 | 55 | 0.8181818 | ||
| Crop | 23.4 | 34.4 | 42.3 | 0.5531915 | 0.8132388 |
| Eye | 66.8 | 33.2 | 2.0120482 | ||
| Intestine | 31.2 | 42 | 26.8 | 1.1641791 | 1.5671642 |
| Leg, front | 44.9* | 33.4 | 21.7 | 2.0691245 | 1.5391705 |
| Leg, middle | 46.5 | 31.2 | 22.3 | 2.0852017 | 1.3991032 |
| Leg, rear | 27.2 | 39 | 33.8 | 0.80473375 | 1.1538461 |
| Mandibular gland | 5.3 | 49.6 | 45.1 | 0.11751663 | 1.0997783 |
| Rectum | 4.4 | 59.6 | 36.1 | 0.12188366 | 1.6509695 |
| Salivary gland, cerebral | 88.6 | 11.4 | 7.7719297 | ||
| Salivary gland, thoracic | 18.6 | 43.7 | 37.7 | 0.4933687 | 1.1591512 |
| Sternite | 26.8 | 52.6 | 20.6 | 1.3009709 | 2.5533981 |
| Tergite | 5.5 | 94.5 | 0.05820106 | ||
| Ventriculus | 5.5 | 18.7 | 75.8 | 0.072559364 | 0.24670185 |
| Thoracic muscle | |||||
| Fat body | 28.2 | 26 | 45.8 | 0.6157205 | 0.5676856 |
| Malpighian tubules | |||||
| Nerve chord | 31.2 | 40.5 | 28.4 | 1.0985916 | 1.4260564 |
| Poison sac | 40.9 | 59.1 | 0.69204736 | ||
| Sting | 41 | 59 | 0.69491524 | ||
| Heart | 30.5 | 27.1 | 42.3 | 0.7210402 | 0.64066195 |
| Hypopharyngeal gland | 38.5 | 61.5 | 0.62601626 | ||
| Galea | 24.5 | 23.9 | 51.7 | 0.4738878 | 0.4622824 |
| Glossa | 10.2 | 42.3 | 47.5 | 0.21473685 | 0.8905263 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.6 | 39.5 | 42.7 | 0.6229508 | 0.92505854 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQKLIFLTVLFFCGVIGENCEDNNKKEECALAPLDQDKNWKSASTIYDFHAKDIHGNDVS LNKYRGHVCIIVNVASNCGLTDTNYRELVQLYEKYNEKEGLRILAFPSNEFGGQEPGTSV EILEFVKKYNVTFDLFEKINVNGDNAHPLWKWLKTQANGFITDDIKWNFSKFIINKEGKV VSRFAPTVDPLQMESELKKYF |
 Top
| |