| Protein: 60115688 NP_001012431.1 icarapin-like precursor |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 17.9 | 65.1* | 17 | 1.0529412 | 3.8294117 |
| Scape | 23 | 55.2* | 21.9 | 1.0502284 | 2.5205479 |
| Brain | 64.2 | 35.8 | 1.7932961 | ||
| Crop | 41.9 | 37.1 | 21.1 | 1.985782 | 1.7582939 |
| Eye | 51 | 49 | 1.0408163 | ||
| Intestine | 8.3 | 68* | 23.8 | 0.3487395 | 2.857143 |
| Leg, front | 81* | 19 | 4.263158 | ||
| Leg, middle | 80.9* | 19.1 | 4.235602 | ||
| Leg, rear | 18.1 | 70.3* | 11.6 | 1.5603448 | 6.0603447 |
| Mandibular gland | 2.2 | 38.4 | 59.4 | 0.037037037 | 0.64646465 |
| Rectum | |||||
| Salivary gland, cerebral | 14.2 | 40.7 | 45.1 | 0.31485587 | 0.902439 |
| Salivary gland, thoracic | 10.8* | 53.5 | 35.7 | 0.30252102 | 1.4985994 |
| Sternite | 8.6 | 58.4 | 33.1 | 0.25981873 | 1.7643504 |
| Tergite | 5.9 | 49.6 | 44.5 | 0.13258427 | 1.1146067 |
| Ventriculus | |||||
| Thoracic muscle | 76.7 | 23.3 | 3.2918456 | ||
| Fat body | 8.9 | 10.1* | 81.1 | 0.10974106 | 0.12453761 |
| Malpighian tubules | 84.5* | 15.5 | 5.451613 | ||
| Nerve chord | 18.5 | 62.6 | 18.9 | 0.978836 | 3.3121693 |
| Poison sac | 44.6 | 55.4 | 0.8050541 | ||
| Sting | 24.5 | 75.5 | 0.3245033 | ||
| Heart | 5.4 | 29 | 65.6 | 0.08231708 | 0.44207317 |
| Hypopharyngeal gland | 9.6 | 90.4 | 0.10619469 | ||
| Galea | 15.8 | 68.5* | 15.7 | 1.0063695 | 4.363057 |
| Glossa | 18.1 | 69.6* | 12.3 | 1.4715447 | 5.6585364 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.9 | 51.5 | 37.1 | 0.64420485 | 1.3881402 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTLGVLFIAAWFIACTHSFPGAHDEDSKEERKNVDTVLVLPSIERDQMMAATFDFPSLS FEDSDEGSNWNWNTLLRPNFLDGWYQTLQSAISAHMKKVREQMAGILSRIPEQGVVNWNK IPEGANTTSTTKIIDGHVVAINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEAD SDVTTLPTLIGKNETSTQSSRSVESVEDFDNEIPKNQGDVLTA |
 Top
| |