| Protein: 328777360 XP_624571.2 PREDICTED: endoplasmic reticulum resident protein 44 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 36.4 | 39.7 | 23.9 | 1.5230125 | 1.6610879 |
| Brain | 60.9 | 39.1 | 1.5575447 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 70.8 | 29.2 | 2.4246576 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 74.6 | 25.4 | 2.937008 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 89.8 | 10.2 | 8.803922 | ||
| Salivary gland, thoracic | 38.6 | 25.3 | 36.2 | 1.0662984 | 0.69889504 |
| Sternite | 57.1 | 42.9 | 1.3310024 | ||
| Tergite | |||||
| Ventriculus | 50.3 | 28.5 | 21.2 | 2.3726416 | 1.3443396 |
| Thoracic muscle | |||||
| Fat body | 36.5 | 45.7 | 17.8 | 2.050562 | 2.5674157 |
| Malpighian tubules | 29.8 | 32.6 | 37.6 | 0.7925532 | 0.86702126 |
| Nerve chord | 58.7 | 13.2 | 28 | 2.0964286 | 0.47142857 |
| Poison sac | 56.5 | 43.5 | 1.2988505 | ||
| Sting | |||||
| Heart | 17.5 | 55.2 | 27.3 | 0.64102566 | 2.0219781 |
| Hypopharyngeal gland | 32.3 | 67.7 | 0.47710487 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 48 | 43.2 | 32.1 | 1.4953271 | 1.3457944 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLVFCDIFDFKVLIFACLLAFLPHNFANDTNEGALSLTQQNIDMTLATNELVFINFYAQW CRFSNSLAPIFEEAANKIKNAFPEPGKVVMAKVDCERESSIASRFHITKYPTLKVIRNGQ PTKREYRGQRSVEAFEEFIKKQLEDPIKEFYDLKELTNLDDKKRMIIGYFDRKDVPEYEM FRRVATNLKDDCQFHVGFGTCSAQNCEIGEHFHFLNASKAMHPPGEPIIVFRSDKALSND EDETYHGSLNNFDELNVWAQEKCVPFVREITFENAEELTEEDLPFLILFHAPDDVESVKM YKDVVSRTLLDEKQNVNFLTADGMKFAHPLHHLGKTPADLPLIAIDSFRHMYLFPNFNDI HVEGKLKAFLRDLYSGKLHREFHYGPDPSNEVREIVGQIKVPTTPPESTFKKLAPSKNRY TLLKDEL |
 Top
| |