Home List proteins by tissue Protein search Downloads Links
Protein: 328789361 XP_623196.3 PREDICTED: transketolase isoform 1
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 33.1 29.5 37.4 0.88502675 0.7887701
Scape 18.9 49 32.1 0.58878505 1.5264797
Brain 88.5* 11.5 7.695652
Crop 26.5 33.1 40.3 0.6575682 0.82133996
Eye 88.4* 8.9 2.7 32.74074 3.2962964
Intestine 37 33.4 29.6 1.25 1.1283784
Leg, front 35.9 39.8 24.3 1.4773662 1.6378601
Leg, middle 31.7 44.6 23.7 1.3375528 1.8818566
Leg, rear 73.7 15.7 10.7 6.8878503 1.4672897
Mandibular gland 60.2 39.8 1.5125629
Rectum 15.6 67.9 16.5 0.94545454 4.1151514
Salivary gland, cerebral 69.5 12.9 17.6 3.9488637 0.73295456
Salivary gland, thoracic 31.2 23.2 45.6 0.68421054 0.50877196
Sternite 13.6 47.7 38.6 0.3523316 1.2357513
Tergite 3.5 72.9 23.6 0.14830509 3.088983
Ventriculus 12.8 72.1 15.1 0.8476821 4.7748346
Thoracic muscle
Fat body 8.5 45.2 46.2 0.18398269 0.978355
Malpighian tubules 30.4 40.2 29.4 1.0340136 1.3673469
Nerve chord 13.4 49.7 36.9 0.36314362 1.3468834
Poison sac 14.4 85.6 0.1682243
Sting 57.5 42.5 1.3529412
Heart 2.5* 58.4 39.1 0.06393862 1.4936061
Hypopharyngeal gland 73.1 26.9 2.717472
Galea 48.1 24.4 27.5 1.7490909 0.8872727
Glossa 42.8 32.5 24.7 1.7327936 1.3157895
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 33.2 43.1 30.7 1.0814332 1.4039088
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MVRDINVENLQDLANRLRIQCIKATEASKSGHPTSCSSMAEIMSVLFFHTMRYKVSAPRD
LSSDRFVLSKGHAAPILYAAWAEAGLFPTSELLNLRKLDSDLEGHPTPRLNFIDVGTGSL
GQGLSVSAGMAYVGKNFDKANYRVYCLIGDGEAAEGSIWEALHFASYYKLDNLCAIFDIN
RLGQSEPTSLQHNMEVYRKRLEAFGFNALVVDGHDVEELAKAFHEAQNTKGRPTAILAKT
YKGKYFPTIEDQENWHGKPLGNKANEVIQHLTGMLKNPGPLGLHPQKPLVDDVSVVDVNN
IKLASPPNYKLGEQVATRLAYGTALVKLAKNNSRVIALDGDTKNSTYAEKIKTVDPSRFI
EGFIAEQNVVGVAIGAACRDRTVAFVSAFATFFTRAFDQIRMGAISQTNVNFVGSHCGVS
IGEDGPSQMGLEDIAMFRTIPGSTVFYPADAVATERAIELAANTKGICFIRTSRPATAVI
YKNEEPFVIGKGKVVKSSAKDQVLVIGAGVTLYEALKAADELSKVGINIRVIDPFTIKPL
DAQLIVKNAKEVGGRVITVEDHYAEGGLGEAVLSAVALERNVVVKKLAIPEVPRSGPPTA
LLDKYGISSNKIVAAVQEILKL

Top