| Protein: 328783393 XP_001121483.2 PREDICTED: hypothetical protein LOC725661 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.2 | 45.2 | 27.5 | 0.9890909 | 1.6436363 |
| Scape | 39.8 | 26.5 | 33.7 | 1.1810089 | 0.78635013 |
| Brain | 28.3 | 71.7 | 0.39470014 | ||
| Crop | 42.9 | 28.9 | 28.3 | 1.5159011 | 1.0212014 |
| Eye | 20.2 | 31 | 48.7 | 0.4147844 | 0.6365503 |
| Intestine | 41.7 | 20 | 38.3 | 1.0887729 | 0.5221932 |
| Leg, front | 38.5 | 33.4 | 28.1 | 1.3701068 | 1.1886121 |
| Leg, middle | 34.8 | 37.7 | 27.4 | 1.2700729 | 1.3759124 |
| Leg, rear | 26.7 | 40.4 | 33 | 0.8090909 | 1.2242424 |
| Mandibular gland | 54.4 | 45.6 | 1.1929824 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 70.3* | 6.7 | 23 | 3.0565217 | 0.29130435 |
| Sternite | 14.5 | 19 | 66.4 | 0.21837349 | 0.28614458 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 29 | 36.5 | 34.4 | 0.84302324 | 1.0610465 |
| Malpighian tubules | 31.5 | 33.5 | 35 | 0.9 | 0.95714283 |
| Nerve chord | 34.4 | 24.9 | 40.7 | 0.8452088 | 0.61179364 |
| Poison sac | 14.4 | 85.6 | 0.1682243 | ||
| Sting | |||||
| Heart | 3.3 | 48.5 | 48.1 | 0.06860707 | 1.008316 |
| Hypopharyngeal gland | 30.4 | 69.6 | 0.43678162 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34 | 29.7 | 43.6 | 0.7798165 | 0.68119264 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIRFCNICYFVFILIVTFQILSSHADNAVPVLLWGGSVNSDLAQTGAVNPFLKTTSEEFD LFLHKKLENSPPVLLYIKDNLCIEDLVKHKQHLQKVITSKSYFPAVEKAMNTVENLPFYN QTYNDYMDSISDGQLLIVPINNLDIIPETYKTIRDSSPNLIAILTGKACNYRRSERVKRD ILTNNKDKHFIVSSHRVLLYSSQPLLLKLENNKNEIELLNFISYKDEPGTKKSSSNLILT FNETMNQHELVFMFEVKTAGYFTLKTVQYTYYINSKLSNQQNLITNTDIVFPFNFSYHCS QNIIFKNDTIRLHITDLQVQLIPENKNNTRTFNDAYDCVGFTSIPIWTGIFVTAILALIM IWALTMIIDIRTMDRFDDPKGKTITISSQE |
 Top
| |