| Protein: 328782411 XP_003250139.1 PREDICTED: hypothetical protein LOC100577527 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 54.5 | 45.5 | 1.1978022 | ||
| Eye | |||||
| Intestine | 34.8 | 39.1 | 26.2 | 1.3282443 | 1.4923664 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 38 | 1.3 | 60.8 | 0.625 | 0.02138158 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 21 | 79 | 0.2658228 | ||
| Ventriculus | 96.5* | 3.5 | 27.571428 | ||
| Thoracic muscle | |||||
| Fat body | 92.4 | 0.4* | 7.2 | 12.833333 | 0.055555556 |
| Malpighian tubules | 65.7* | 15.5 | 18.8 | 3.494681 | 0.8244681 |
| Nerve chord | 29.4 | 70.6 | 0.4164306 | ||
| Poison sac | 33 | 67 | 0.49253732 | ||
| Sting | 43.7 | 56.3 | 0.7761989 | ||
| Heart | 10.1 | 61.8 | 28 | 0.3607143 | 2.2071428 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.6 | 37.5 | 42.1 | 1.0356295 | 0.89073634 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFRTIAVVLVVALPLIQASSIDISQRSKYHLEFTSKDAVQQSKSNPFIEERSGFIGDLTI GSHRSDEQIFYREVELNNPNSAVGSLELKLSVKNGILHYVSATNYAGSQAVICDRPNILG ASEGIINIRLTGNTKATLLLIIAAH |
 Top
| |