Home List proteins by tissue Protein search Downloads Links
Protein: 66531434 XP_624112.1 PREDICTED: v-type proton ATPase subunit B-like
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 27.4 30.8 41.9 0.65393794 0.7350835
Scape 22.9 37.7 39.3 0.5826972 0.9592875
Brain 26.6 28 45.5 0.5846154 0.61538464
Crop 38.5 37.9 23.7 1.6244726 1.5991561
Eye 46.6 33.5 19.8 2.3535354 1.6919192
Intestine 34.3 27.8 37.9 0.9050132 0.73350924
Leg, front 39.8 24.6 35.6 1.1179775 0.69101125
Leg, middle 35.8 29.7 34.5 1.0376811 0.8608696
Leg, rear 33.7 32.8 33.5 1.0059701 0.97910446
Mandibular gland 82 18 4.5555553
Rectum 8.7 67.7 23.6 0.36864406 2.868644
Salivary gland, cerebral 41 28.3 30.6 1.3398693 0.9248366
Salivary gland, thoracic 58.1 7.6* 34.2 1.6988304 0.22222222
Sternite 37.4 34.8 27.8 1.3453237 1.2517985
Tergite 42.3 31.8 25.9 1.6332046 1.2277992
Ventriculus 10.7 28.5 60.8 0.17598684 0.46875
Thoracic muscle 41 59 0.69491524
Fat body 52.7 26.7 20.6 2.5582523 1.2961165
Malpighian tubules 31 31.6 37.3 0.8310992 0.847185
Nerve chord 27.7 24.7 47.6 0.5819328 0.51890755
Poison sac 79.9 20.1 3.9751244
Sting 57.5 42.5 1.3529412
Heart 29.7 25.6 44.7 0.66442955 0.57270694
Hypopharyngeal gland 58.6 41.4 1.4154589
Galea 32.2 30.2 37.6 0.85638297 0.8031915
Glossa 35.6 36.3 28.1 1.2669039 1.2918149
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 36.3 35.5 35.1 1.034188 1.011396
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MYPKSIGERQANKEHVLAVSRDFISQPRLTYKTVSGVNGPLVILDEVKFPKFAEIVQLKL
ADGSTRSGQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDTLRTPVSEDMLGRVFNGSG
KPIDKGPPILAEDFLDIEGQPINPWSRIYPKEMIQTGISAIDVMNSIARGQKIPIFSAAG
LPHNEIAAQICRQAGLVKLPGKSVLDSHEDNFAIVFAAMGVNMETARFFKQDFEENGSME
NVCLFLNLANDPTIERIITPRLALTAAEFLAYQCEKHVLVILTDMSSYAEALREVSAARE
EVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDDITHPIPDLTGYITEG
QIYVDRQLHNRQIYPPVNVLPSLSRLMKSAIGEGWTRKDHSDVSNQLYACYAIGKDVQAM
KAVVGEEALTPDDLLYLEFLSKFEKNFISQGSYENRTVFESLDIGWQLLRIFPKEMLKRI
PTNILAEFYPRDSRH

Top