| Protein: 58585106 NP_001011583.1 chemosensory protein 3 precursor |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.7* | 19.3 | 27 | 1.9888889 | 0.71481484 |
| Scape | 38.2* | 48.3* | 13.5 | 2.8296297 | 3.5777779 |
| Brain | 91.5* | 8.5 | 10.764706 | ||
| Crop | 20.7 | 42.9 | 36.5 | 0.5671233 | 1.1753424 |
| Eye | 47.3 | 52.7 | 0.8975332 | ||
| Intestine | 32.6 | 45.9 | 21.6 | 1.5092592 | 2.125 |
| Leg, front | 43.9 | 17.8 | 38.3 | 1.1462141 | 0.46475196 |
| Leg, middle | 37.1 | 19.4 | 43.5 | 0.85287356 | 0.445977 |
| Leg, rear | 26.4 | 20.5 | 53.1 | 0.49717513 | 0.38606402 |
| Mandibular gland | 2.3 | 53.4 | 44.3 | 0.051918738 | 1.2054176 |
| Rectum | 70 | 30 | 2.3333333 | ||
| Salivary gland, cerebral | 76.1 | 18.5* | 5.4 | 14.092592 | 3.425926 |
| Salivary gland, thoracic | 69* | 10.9 | 20 | 3.45 | 0.545 |
| Sternite | 21.9 | 14.6 | 63.6 | 0.3443396 | 0.22955975 |
| Tergite | 42.5 | 21 | 36.5 | 1.1643835 | 0.5753425 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 75.6 | 1.5* | 22.9 | 3.30131 | 0.06550218 |
| Malpighian tubules | 89.2* | 3.6 | 7.2 | 12.388889 | 0.5 |
| Nerve chord | 18.1 | 32.4 | 49.5 | 0.36565655 | 0.6545454 |
| Poison sac | 18.3 | 81.7 | 0.2239902 | ||
| Sting | 2.8* | 97.2 | 0.028806584 | ||
| Heart | 47.3 | 9.5* | 43.2 | 1.0949074 | 0.2199074 |
| Hypopharyngeal gland | 99.2* | 0.8 | 124 | ||
| Galea | 16.2 | 38.5 | 45.3 | 0.3576159 | 0.84988964 |
| Glossa | 15.2 | 33.9 | 50.9 | 0.29862475 | 0.6660118 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.7 | 31.9 | 37.2 | 1.094086 | 0.8575269 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKVSIICLVLMAAIVLVAARPDESYTSKFDNINVDEILHSDRLLNNYFKCLMDEGRCTAE GNELKRVLPDALATDCKKCTDKQREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFE EEAKKLGINV |
 Top
| |