| Protein: 328792906 XP_624498.2 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP1A |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.4 | 24.3 | 33.3 | 1.2732732 | 0.7297297 |
| Scape | 39.4 | 28.2 | 32.5 | 1.2123077 | 0.8676923 |
| Brain | 42.5 | 29.2 | 28.3 | 1.5017668 | 1.0318022 |
| Crop | 54.2 | 45.8 | 1.1834061 | ||
| Eye | |||||
| Intestine | 66.3 | 33.7 | 1.9673591 | ||
| Leg, front | 51.5* | 22.5 | 26 | 1.9807693 | 0.86538464 |
| Leg, middle | 42.8 | 23.7 | 33.5 | 1.277612 | 0.70746267 |
| Leg, rear | 22.1 | 44.1 | 33.8 | 0.65384614 | 1.3047338 |
| Mandibular gland | 30.3 | 69.7 | 0.43472022 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 29.9 | 34.4 | 35.7 | 0.837535 | 0.96358544 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 47.8 | 20.8 | 31.4 | 1.522293 | 0.6624204 |
| Thoracic muscle | |||||
| Fat body | 88.1* | 11.9 | 7.4033613 | ||
| Malpighian tubules | 41.3 | 32.3 | 26.4 | 1.564394 | 1.2234849 |
| Nerve chord | 46.5 | 33.6 | 19.9 | 2.3366835 | 1.6884422 |
| Poison sac | |||||
| Sting | |||||
| Heart | 57.4* | 30.9 | 11.6 | 4.948276 | 2.663793 |
| Hypopharyngeal gland | 24.3 | 75.7 | 0.32100397 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.8 | 33.5 | 34.3 | 1.3061224 | 0.9766764 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGVDVEVLSPGDGQTYPKTGQTVVVHYTGTLDNGKKFDSSRDRGVPFKFKIGKGEVIKGW DQGVAKMCVGERARLTCSPDFAYVLSLT |
 Top
| |