| Protein: 328780997 XP_393297.4 PREDICTED: hypothetical protein LOC409805 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 43.8 | 22 | 34.2 | 1.2807018 | 0.64327484 |
| Brain | |||||
| Crop | 32.5 | 14.1 | 53.4 | 0.6086142 | 0.26404494 |
| Eye | |||||
| Intestine | 54.2 | 45.8 | 1.1834061 | ||
| Leg, front | 28 | 47 | 25 | 1.12 | 1.88 |
| Leg, middle | 38.1 | 61.9 | 0.6155089 | ||
| Leg, rear | |||||
| Mandibular gland | 37.5 | 41.8 | 20.8 | 1.8028846 | 2.0096154 |
| Rectum | |||||
| Salivary gland, cerebral | 11.7 | 24.1 | 64.2 | 0.18224299 | 0.3753894 |
| Salivary gland, thoracic | 31.8 | 40.3 | 27.9 | 1.1397849 | 1.4444444 |
| Sternite | 38.5 | 31.9 | 29.6 | 1.3006756 | 1.0777028 |
| Tergite | 69.5 | 15.1 | 15.3 | 4.542484 | 0.9869281 |
| Ventriculus | |||||
| Thoracic muscle | 25.5 | 74.5 | 0.34228188 | ||
| Fat body | 87.8* | 11.4* | 0.8 | 109.75 | 14.25 |
| Malpighian tubules | 79* | 21 | 3.7619047 | ||
| Nerve chord | 88.7* | 2.8 | 8.5 | 10.435294 | 0.32941177 |
| Poison sac | |||||
| Sting | 35.2 | 64.8 | 0.54320985 | ||
| Heart | 51.9 | 24.5 | 23.6 | 2.1991525 | 1.0381356 |
| Hypopharyngeal gland | |||||
| Galea | 53.5 | 23.1 | 23.4 | 2.2863247 | 0.98717946 |
| Glossa | 48.3 | 28.5 | 23.2 | 2.0818965 | 1.2284483 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.9 | 27.7 | 34.3 | 1.3965014 | 0.8075802 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDARFRSNLDMIGRNEPITRKARFWQSYVRALKGTDDIRAPEHTHRPRSIFRSDYPELHS TSWPFGKSIFENPIHAADRINVPGYRYLPVHREIYGYSPRQIYPHQYKPVERFIPAKPFD PEQAWADHLNRLADIDKLYPSKSPLLARHISPPLSTKRLFDIHGNLVTDYDYLPSFPSLL RKKPLFDLLEPSVMAPISAFTRDPWWYPSYAPYIPSYAAKSTPFYLRDSYLSPVKRSYLW SRHPIRPFAHAY |
 Top
| |