| Protein: 328780331 XP_624159.2 PREDICTED: grpE protein homolog mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.5 | 31.4 | 30.1 | 1.2790698 | 1.0431894 |
| Scape | 29.9 | 34.1 | 36 | 0.83055556 | 0.94722223 |
| Brain | 51.1 | 48.9 | 1.0449898 | ||
| Crop | 28.5 | 41.2 | 30.3 | 0.9405941 | 1.359736 |
| Eye | |||||
| Intestine | 35.4 | 29.7 | 34.9 | 1.0143267 | 0.8510029 |
| Leg, front | 32 | 32.4 | 35.7 | 0.89635855 | 0.90756303 |
| Leg, middle | 31.4 | 39.8 | 28.8 | 1.0902778 | 1.3819444 |
| Leg, rear | 47.7 | 52.3 | 0.9120459 | ||
| Mandibular gland | 2.2 | 69.6 | 28.2 | 0.07801419 | 2.468085 |
| Rectum | 18 | 69.6 | 12.3 | 1.4634147 | 5.6585364 |
| Salivary gland, cerebral | 72.4 | 27.6 | 2.6231885 | ||
| Salivary gland, thoracic | 44.9 | 22.4 | 32.6 | 1.3773006 | 0.68711656 |
| Sternite | 48.5 | 32.6 | 18.9 | 2.5661376 | 1.7248677 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 7 | 53.7 | 39.3 | 0.17811705 | 1.3664122 |
| Fat body | 51.3 | 28.5 | 20.2 | 2.539604 | 1.410891 |
| Malpighian tubules | 28.9 | 34.9 | 36.2 | 0.7983425 | 0.9640884 |
| Nerve chord | 30.9 | 33.3 | 35.8 | 0.8631285 | 0.9301676 |
| Poison sac | |||||
| Sting | 69.7 | 30.3 | 2.30033 | ||
| Heart | 43.3 | 22.7 | 34 | 1.2735294 | 0.66764706 |
| Hypopharyngeal gland | 75.6 | 24.4 | 3.0983605 | ||
| Galea | |||||
| Glossa | 30.3 | 26.7 | 43 | 0.7046512 | 0.62093025 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.5 | 42.1 | 32.4 | 1.0648148 | 1.2993827 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKLRTMASFVVPVATRFTRVTIDSLHNINKNILLRLIQPSHVSWQRQEYSTITEEQKSES GEPVLELTENERKLKADIELINKELMDLKNHKNDLEDKYKRALADGENLRVRLNKQIQDA KMFGIQGFCKDLLEVADILGKATESVPKNELTEKNPHLKTLYEGLKMTEAQLHKVFKKHG LVSLNPLNEKFDPNQHEALFQQEVEGKEPGTIVVVSKLGYKLHERVVRPALVGVAKG |
 Top
| |