| Protein: 66522796 XP_392591.2 PREDICTED: pyridoxine-5'-phosphate oxidase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 52.9 | 47.1 | 1.1231422 | ||
| Scape | |||||
| Brain | |||||
| Crop | 11.9* | 88.1 | 0.13507378 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 54.1 | 45.9 | 1.1786492 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 35.4 | 18.4 | 46.2 | 0.76623374 | 0.3982684 |
| Tergite | 4.1* | 95.9 | 0.04275287 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 18.8* | 26.6 | 54.7 | 0.34369287 | 0.48628885 |
| Nerve chord | 56.7 | 43.3 | 1.3094689 | ||
| Poison sac | 0.7 | 99.3 | 0.007049345 | ||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 46.7 | 53.3 | 0.8761726 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.6 | 19.7 | 63.7 | 0.6530612 | 0.30926216 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSHSTSQNKNYNIIIGDMRIAYKDKNETFTEDHLVSKEPIGQFRAWFDEACKIPQIFEAN TMFLATATKNGIPSVRPVLLKDYGEDGFKFYTNYESRKAREIAENPNVEVNFYWQPLHRS VRIAGTIKKTSLKDSERYFQSRPYASQIGSMASKQSSVIANRNTLIIKERELLAQFPEGK VKKPDWWGGYIIIPHSIEFWQGQSDRLHDRIHFRRLKPNEKIDNVLVHQGDNGWVYERLS P |
 Top
| |