| Protein: 283436152 NP_001164444.1 peroxiredoxin-like protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 13.7* | 53.7 | 32.6 | 0.4202454 | 1.6472392 |
| Scape | 18.9 | 50.4 | 30.7 | 0.61563516 | 1.6416938 |
| Brain | 63.1 | 36.9 | 1.7100271 | ||
| Crop | 49.2 | 11.6 | 39.2 | 1.255102 | 0.29591838 |
| Eye | 94.8* | 5.2 | 18.23077 | ||
| Intestine | 39 | 30.7 | 30.2 | 1.2913908 | 1.0165563 |
| Leg, front | 22.1 | 45.6 | 32.3 | 0.68421054 | 1.4117647 |
| Leg, middle | 33.6 | 40.9 | 25.5 | 1.3176471 | 1.6039215 |
| Leg, rear | 48 | 34.3 | 17.7 | 2.7118645 | 1.9378531 |
| Mandibular gland | 79.3 | 20.7 | 3.8309178 | ||
| Rectum | 32.9 | 40.5 | 26.6 | 1.2368422 | 1.5225564 |
| Salivary gland, cerebral | 48.9 | 19.6 | 31.5 | 1.5523809 | 0.62222224 |
| Salivary gland, thoracic | 30.7 | 30 | 39.3 | 0.7811705 | 0.7633588 |
| Sternite | 10.1 | 53.1 | 36.8 | 0.27445653 | 1.4429348 |
| Tergite | 7.2 | 41.7 | 51.1 | 0.1409002 | 0.81604695 |
| Ventriculus | 25.5 | 30.6 | 43.9 | 0.5808656 | 0.6970387 |
| Thoracic muscle | |||||
| Fat body | 7 | 44.8 | 48.1 | 0.14553015 | 0.9313929 |
| Malpighian tubules | 26.7 | 30 | 43.3 | 0.61662817 | 0.69284064 |
| Nerve chord | 15.9 | 61.7 | 22.5 | 0.70666665 | 2.7422223 |
| Poison sac | 76.6 | 23.4 | 3.2735043 | ||
| Sting | 44.1 | 55.9 | 0.7889088 | ||
| Heart | 18.2 | 46.2 | 35.6 | 0.51123595 | 1.2977529 |
| Hypopharyngeal gland | 67.1 | 32.9 | 2.0395136 | ||
| Galea | 19.4 | 39.6 | 41 | 0.47317073 | 0.96585363 |
| Glossa | 9.7 | 65.6 | 24.6 | 0.39430895 | 2.6666667 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.8 | 46.5 | 33.1 | 0.83987916 | 1.4048338 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRINSIVPNFEADTTQGQINFYDWQGDSWVVLFSHPADFTPVCTTELGRLAVHQPHFKRR NTKLLAHSVDKLQDHVDWVNDIKSYCQDIPGAFPYPIIADHDRTLAVKLDMIDEISKDDP EQALTVRALYIISPDHRLRLSMHYPTSTGRNVDEILRVIDSLQLVDKRPEIATPANWVPG EKVMILPTVKDEELPKLFPKGVDKVSMPSGKIYVRTTTNY |
 Top
| |