| Protein: 66542933 XP_624945.1 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 26.5 | 73.5 | 0.3605442 | ||
| Brain | |||||
| Crop | 35.4 | 64.6 | 0.54798764 | ||
| Eye | |||||
| Intestine | 52.4 | 47.6 | 1.1008403 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 28.4 | 71.6 | 0.39664805 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 42.6 | 57.4 | 0.74216026 | ||
| Malpighian tubules | |||||
| Nerve chord | 42.1 | 57.9 | 0.7271157 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 10.8 | 89.2 | 0.12107623 | ||
| Hypopharyngeal gland | 22.3 | 77.7 | 0.28700128 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.7 | 67.4 | 0.5296736 | ||
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKFCTFQNCKAYVKKSLQYIPTLGWGWKFSEYIFLERNWEKDKEIIRSQIREFGNYPDNI SLLLCPEGTRITPQKLKASQKFAQKEGLPILKYHLTPRTKGFTASIPYMRDKIPAIYNMQ VQFNSNDSVKPTITNLLLGKRILGHIYMQRIPMKEIPEDQEAAAEWLHKLYEKKDRMAES FEKTGDFFATSGVAKVNKITLKRRYYSLINTICWTVIVVVPMIYYLINLFLSGSTIYFSI GIGTIFLFYILMQKTIGISKISSSSSYGTGELK |
 Top
| |